SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068YA57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YA57
Domain Number 1 Region: 6-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-79
Family Capz beta-1 subunit 0.0000000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068YA57
Sequence length 273
Comment (tr|A0A068YA57|A0A068YA57_ECHMU) F actin capping protein subunit beta {ECO:0000313|EMBL:CDS40155.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000772300 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MLGPHDDQINSAMDLLRRMPPQKLEHVLQSVLDICPQISDAVLSMVDQPMKIKKDPNAGR
DYLLSDFNRDGDSFRSPWTNVYDPPLDDGVLPSERLRALEIEANNAFDQYRAMYFEGGIS
SVYCWDLDQGFAMAILIKKTGNSTSVRGSWDSVHIVEVQEHSTAKSAHYKLTSTIIMWID
TNTHECGSSALGGHFTRMKEHEYPLIDQRQHISNIGSMVEELESQMRSFLNDVYFGSSKA
IIDSMRTYRTAEEEQQQRQLAQSARQVVQQRSQ
Download sequence
Identical sequences A0A068YA57
EmuJ_000772300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]