SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YI28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YI28
Domain Number 1 Region: 27-88
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000602
Family Skp1 dimerisation domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068YI28
Sequence length 157
Comment (tr|A0A068YI28|A0A068YI28_ECHMU) S phase kinase associated protein SKR 1 {ECO:0000313|EMBL:CDS41966.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000965900 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MISNMVRKVLYWCAHHRGRDASKENRTCDAASWEREFSQISESSAFDILLTASCLVIKNL
CEMCCQVIANLTRRGSHPETRRLFNVPSQVIFDLPLYLHRAAWPLGRASNSKPFCVANAS
ILPKYYVFGRSQDATSVTVESEPGLKGHLSWFLLLSD
Download sequence
Identical sequences A0A068YI28
EmuJ_000965900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]