SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A068YW40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YW40
Domain Number 1 Region: 611-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068YW40
Sequence length 756
Comment (tr|A0A068YW40|A0A068YW40_9BURK) Sulfate permease {ECO:0000313|EMBL:CDS52903.1} KW=Complete proteome; Reference proteome OX=1504672 OS=Polaromonas sp. CG9_12. GN= OC=Comamonadaceae; Polaromonas.
Sequence
MLWPMHASPESPRATSAHRLARRLLERLFGNWVRWVTPATLRADAMAGLLGAVLVLPQGI
AFATLAGLPPEYGLYTAIVPCIIAALFGSSWHVMSGPTNANSLALFAMLSPLALAFSPAY
IQLALAVTVMVGVLQWLIGALRLGMLANFISPAVLFGFTSGAALLIAVHALPDFLGIAAA
PEHGAGAVLAHVFTQLPSAKPAALIVAVITLAVALGLRRYRRNWPYMLIGLVVATLLAWV
WSRFLGSGATPSSSLRVVGQIATPWPRFELPRISWAQASDLVGLAFALTIVALGQAISIA
KTVALRSGQRIDANREFRGQGLSNIIGGFFSSYVSCGSMNRSMPNLQAGARTPLASVFSA
LLLLGLVAISSQLLAQIPMAALSALLLLVALSLLDFARWRQLFSLSRTDFGVALATMVAT
VTIRLEMAILLGMLLSLMSFLYRTSRPAMRSMGFDSRGLDRQLVVIDDAPQASEEARAAP
APSGGSADRVVTSVGATAASAGPPQARPAPSGGSAVHEVTSVGATAASAGPPQARPAPSG
GSAVHEVTSVGATAASAGPPQARPAPSGGSAVHEVTSVGATAASAGPPQARPAPSGGSAV
HEVTSVGATFLPECPQLKLLRMEGEVYFGAIQHVADILHALRTQPNPQKHLLVMAKSMNF
IDLAGAELWEAELAARRAMGGNLYFHRPRPEVIHMWRKTGFTNVLGWEHQFSDKFTAIAT
IFGKLDPDICRHCSARIFEECKTAAGADDPANQPTS
Download sequence
Identical sequences A0A068YW40
WP_036807629.1.50118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]