SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DGL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DGL6
Domain Number 1 Region: 14-135
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000133
Family Family 1 bi-partite nucleotidyltransferase subunit 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069DGL6
Sequence length 135
Comment (tr|A0A069DGL6|A0A069DGL6_9BACL) Uncharacterized protein {ECO:0000313|EMBL:GAK41540.1} KW=Complete proteome; Reference proteome OX=1499968 OS=Paenibacillus sp. TCA20. GN=TCA2_4031 OC=Paenibacillus.
Sequence
MNDVILNKTATIERCVRRIHEVYEGNPANLTDFTKQDSIILNIQRACEASIDLAMHIVSN
RKLGVPKASRDAFKLLLDAGLIEDSLAKTMMNMVGFRNIAVHDYQTLELEILEAIIEKHV
DDFKVFTKVILKLEE
Download sequence
Identical sequences A0A069DGL6
WP_047912624.1.55887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]