SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A069DHC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DHC9
Domain Number 1 Region: 245-439
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.98e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 3-163
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-44
Family Methylesterase CheB, C-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 995-1152
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.09e-39
Family Histidine kinase 0.0062
Further Details:      
 
Domain Number 4 Region: 824-928
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.02e-21
Family Flavin-binding PAS domain 0.011
Further Details:      
 
Domain Number 5 Region: 174-247
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000876
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0071
Further Details:      
 
Domain Number 6 Region: 936-1003
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000942
Family Homodimeric domain of signal transducing histidine kinase 0.0024
Further Details:      
 
Domain Number 7 Region: 740-816
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000704
Family Flavin-binding PAS domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A069DHC9
Sequence length 1166
Comment (tr|A0A069DHC9|A0A069DHC9_9BACL) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1499968 OS=Paenibacillus sp. TCA20. GN=TCA2_4352 OC=Paenibacillus.
Sequence
MLPDSGMSFVVVQHLSPDYKSLMSEILSKYTTMPIWVAEHEMEILPNHVYLIPPRKTMTI
RDGKLQLADAVRQSAIHLSIDDFFVSLAAEYGNRAVGVVLSGTGTDGSKGVIEIKKAGGL
VIVQDGQSAKFDGMPSSAKMTGKVDEILNPKDMSERLLQHIRSFGVYPLAGEQERMSTEQ
FIQLIFEKIKEESGIDFTYYKRNSVLRRIERRMAMNNVASVQEYMTYLEEHRDELTSLRK
DLLIGVTNFFRDAEAFQIIYDQVLPRIFEKKSYSKEIRVWVAGCSTGEEAYSIAILLKKY
AQQLGDDYNIKIFATDLDKESIEYASQGIYSESNIHHLSEEDVERFFIRDDDMFHVSKDI
RKMVIFAPQNIIKDPPFRNLDMVTCRNMLIYLQPEMQVKVLSLFHFALNPEGFLFLGPSE
TLGRFANQFEAFDRRWNIFCHKSGKMSSDSESDSQSFSMEGRSSGQHSYRRTAAATVQPR
EQVHVKRSGDLYTMLAEEHISPGMVVNHHNDVIHLVGAINEYLVLSQGKPSWNLYKMIDQ
NVAVTVSTGIQKVRDSLQNVVYPALRIHTNQGDRLIDLHIRPFSRKNKAYDKYVLLLFED
PQHLKQAEEVVMEPVHIDNTLKMRIFELEQELQRSEESLQATVEELETSNEELQATNEEL
VAANEELQSANEELQSVNEELVTVNTEFQFKIQELTDVNNDMNNFLGSTRIGTIFLDKRM
CIRRFTPAITKEINLMDVDYGRPIQHISHHFRYEGLVDDAQHVLKTLEPLEKEIQSQDGT
WYSMRILPYRTEDNFTSGVVLTFVNITDLKAVNEELLKLSYAIEQSPSMTIITDVAGKIE
YANPKFTEVTGYALQEAKGRDLGCYSYSEFSMKDVFKTSLDGETWKGEILSYRKNGEEFW
ESVKIIPITDKQGQIIHFVKLSEDISERKNAEEMLRKTEMLSAVGQLAAGIAHEIRNPLT
ALKGFTKLLSKKEDGNAYIEIMLTELNRIEQIVSELLVLAKPQAIEFSEHELEPIIQDVI
MLLETQAIMNNVEITVMYEQKLKVMCVENQLKQVFINVLKNAIEAMPGGGKIDISVTLNE
NDNIVISFVDNGAGIPEAKLARIGEPFYSTKDKGTGLGLMVSYKIIQNHQGTIHIESEVG
RGTGVIIQIPTSNNQARSLLPVEGSL
Download sequence
Identical sequences A0A069DHC9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]