SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A069DRZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DRZ8
Domain Number 1 Region: 9-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.75e-97
Family Capz alpha-1 subunit 0.0000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069DRZ8
Sequence length 287
Comment (tr|A0A069DRZ8|A0A069DRZ8_9HEMI) Putative f-actin capping protein alpha subunit {ECO:0000313|EMBL:JAC86486.1} OX=65343 OS=Panstrongylus megistus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Panstrongylus.
Sequence
MTLDGEEPISDQEKVRIVSNFILHSPPGEFNEVFNDARILLNNDTLLKEGALGVFGQYNK
DQLTPVKIKHSEYNVLITEHNDLGSNRFYDARTKQSFKYDPLRRDTSNYDTWEPEHGTEK
WRAPLEAELDQYIENHYTKGIGSVFSKRDEGKIVLVACIEAHLFQPKNCWNGCWRSQWFV
TIDSDSADVKGILKIQVHYYEDGNVQLVSSKEINSNISISDEEQLAKDLIKLFEDSESDY
QNAISDNYLTMSDTTFKALRRQLPVTRTKIDWSKMVSYSIGKELKPQ
Download sequence
Identical sequences A0A069DRZ8 A0A224XL83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]