SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A069JY94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069JY94
Domain Number 1 Region: 15-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.73e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069JY94
Sequence length 130
Comment (tr|A0A069JY94|A0A069JY94_9ACTN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1487711 OS=Streptomyces sp. NTK 937. GN=DT87_21230 OC=Streptomyces.
Sequence
MTHSTTLVLTVRHPADSLAVVTVSGELDVETAPALRVKAVDLIGQGYAHVVLDMGPVEFC
DSSGLNALIAIVHHAKDHGGSLSVAAAPDQLTRLLYMTGVGGLMPVHADVAGAVAHFTRG
SAAEEDTSGV
Download sequence
Identical sequences A0A069JY94
WP_037879600.1.46143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]