SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069RBA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069RBA1
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily ITPase-like 1.5e-62
Family Maf-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069RBA1
Sequence length 194
Comment (tr|A0A069RBA1|A0A069RBA1_PEPLI) Maf-like protein CLIT_23c03300 {ECO:0000256|HAMAP-Rule:MF_00528} KW=Complete proteome; Reference proteome OX=1121324 OS=Peptoclostridium litorale DSM 5388. GN=CLIT_23c03300 OC=Peptostreptococcaceae; Peptoclostridium.
Sequence
MKKIILSSASPRRKELLEQIGVKFDIIVSDIDENIDGDMDPTEIVKKLALMKAENVYDLE
GNQDAIVIGADTIVVHEGRVIGKPADEKDAFKILSSLSGNINYVYTGVAVVSSESVINFY
EETKVYMKNMTEQDIYEYIKTSEPMDKAGAYGIQGIGAVFVEKIEGDYNNVVGLPLARLY
DVMKELDENLIKWN
Download sequence
Identical sequences A0A069RBA1
WP_038267866.1.12206 WP_038267866.1.46527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]