SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A070A108 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A070A108
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.53e-29
Family Ribosomal L11/L12e N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 6.93e-22
Family Ribosomal protein L11, C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A070A108
Sequence length 141
Comment (tr|A0A070A108|A0A070A108_CHLMR) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome OX=83560 OS=Chlamydia muridarum. GN=BD36_03170 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MSNKKIIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVIT
VYSDKTFSFVMKQPPVSSLIKKALGLESGSKIPNRNKVGKLARAQITAIAEQKMKDMDVV
LLESAERMVEGTARSMGVDVE
Download sequence
Identical sequences A0A070A108 Q9PK76
WP_010230923.1.18971 WP_010230923.1.19393 WP_010230923.1.21797 WP_010230923.1.40339 WP_010230923.1.40903 WP_010230923.1.45721 WP_010230923.1.46238 WP_010230923.1.60880 WP_010230923.1.63773 WP_010230923.1.69188 WP_010230923.1.77803 WP_010230923.1.85209 WP_010230923.1.89087 WP_010230923.1.91588 gi|15835210|ref|NP_296969.1| 243161.TC0593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]