SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A070AGN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A070AGN1
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000785
Family SPO1678-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A070AGN1
Sequence length 103
Comment (tr|A0A070AGN1|A0A070AGN1_9PROT) Transposase {ECO:0000313|EMBL:KDU97246.1} KW=Complete proteome OX=1432055 OS=Komagataeibacter rhaeticus AF1. GN=GLUCORHAEAF1_15660 OC=Acetobacteraceae; Komagataeibacter.
Sequence
MGKVTRKRYGAEFKTRVALEAIRGELTLAELASKHGVHQTMIAQWKRQAIEGMAATFSGK
PVAEPPVSPADVEKLHAKIGELLVERDFLRDASARLGVIRGGR
Download sequence
Identical sequences A0A070AGN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]