SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A070T211 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A070T211
Domain Number 1 Region: 452-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A070T211
Sequence length 559
Comment (tr|A0A070T211|A0A070T211_ECOLX) Putative sulfate transporter ychM {ECO:0000313|EMBL:KDX20063.1} KW=Complete proteome OX=1444180 OS=Escherichia coli 2-210-07_S3_C3. GN=AC45_2214 OC=Enterobacteriaceae; Escherichia.
Sequence
MNKIFSSHVMPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMG
LARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPT
INVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYV
LADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDL
ESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQ
PIPGRLAFFPNRRAAMADL
Download sequence
Identical sequences A0A026VA58 A0A027U414 A0A028A8X2 A0A028E6I7 A0A069XFT5 A0A070FR17 A0A070T211 A0A070UYJ1 A0A073FX69 A0A090NHU0 A0A0E0Y0H1 A0A0E2TPZ6 A0A0F6F588 A0A0H3PWX0 A0A0H7XHQ5 A0A125X5G4 A0A1D8F8W4 A0A1S6TAB5 A0A1X3IP98 A0A1X3J108 A0A1X3JJ81 A0A1X3L560 A0A1X3LIM8 A0A1Z3V3D9 A0A236ML27 A0A2A2XP48 B7LGW7 C8U6W8 C8UNW2 D3QQX9 D6I724 E3PKJ3 E7SUD6 F4NH89 F4SGS3 F4TDA0 F4VDM2 H4UHT5 I2RVH6 I2T183 I2UE12 I2WNH1 I2XHE1 I4SCH6 I6BV79 I6DL70 I6H642 K4VPL0 K4XNH5 M9GHV1 P0AFR2 P0AFR3 V6G347 W1B8K6 W1F8D6
gi|254161288|ref|YP_003044396.1| gi|386708995|ref|YP_006172716.1| gi|254792676|ref|YP_003077513.1| gi|170080834|ref|YP_001730154.1| gi|471333187|ref|YP_007556664.1| gi|388477285|ref|YP_489473.1| gi|218553760|ref|YP_002386673.1| gi|443617298|ref|YP_007381154.1| gi|383178866|ref|YP_005456871.1| gi|251784712|ref|YP_002999016.1| gi|260843498|ref|YP_003221276.1| gi|251784712|ref|YP_002999016.1| gi|387620919|ref|YP_006128546.1| 3133S GO.9224 gi|544389923|ref|YP_008564340.1| NP_309738.2.58667 NP_415724.2.90541 WP_001033352.1.1000 WP_001033352.1.10001 WP_001033352.1.100044 WP_001033352.1.100063 WP_001033352.1.100066 WP_001033352.1.100073 WP_001033352.1.100085 WP_001033352.1.10010 WP_001033352.1.100111 WP_001033352.1.100135 WP_001033352.1.100251 WP_001033352.1.100252 WP_001033352.1.100283 WP_001033352.1.100299 WP_001033352.1.100302 WP_001033352.1.100315 WP_001033352.1.10034 WP_001033352.1.100346 WP_001033352.1.100389 WP_001033352.1.100425 WP_001033352.1.100441 WP_001033352.1.100444 WP_001033352.1.100448 WP_001033352.1.100451 WP_001033352.1.10048 WP_001033352.1.100487 WP_001033352.1.100496 WP_001033352.1.100499 WP_001033352.1.100508 WP_001033352.1.10051 WP_001033352.1.100554 WP_001033352.1.100571 WP_001033352.1.100614 WP_001033352.1.100667 WP_001033352.1.10067 WP_001033352.1.100689 WP_001033352.1.100718 WP_001033352.1.100725 WP_001033352.1.100753 WP_001033352.1.100758 WP_001033352.1.100796 WP_001033352.1.10080 WP_001033352.1.100824 WP_001033352.1.100836 WP_001033352.1.100851 WP_001033352.1.100852 WP_001033352.1.10086 WP_001033352.1.100867 WP_001033352.1.100925 WP_001033352.1.100928 WP_001033352.1.100933 WP_001033352.1.10094 WP_001033352.1.101033 WP_001033352.1.101096 WP_001033352.1.101105 WP_001033352.1.101121 WP_001033352.1.101157 WP_001033352.1.101158 WP_001033352.1.101166 WP_001033352.1.101175 WP_001033352.1.101186 WP_001033352.1.101206 WP_001033352.1.101214 WP_001033352.1.101216 WP_001033352.1.101255 WP_001033352.1.101257 WP_001033352.1.101282 WP_001033352.1.101289 WP_001033352.1.101293 WP_001033352.1.101313 WP_001033352.1.101359 WP_001033352.1.101387 WP_001033352.1.101418 WP_001033352.1.101423 WP_001033352.1.101436 WP_001033352.1.101468 WP_001033352.1.101486 WP_001033352.1.101518 WP_001033352.1.10154 WP_001033352.1.101583 WP_001033352.1.101594 WP_001033352.1.101628 WP_001033352.1.101630 WP_001033352.1.101651 WP_001033352.1.101653 WP_001033352.1.101654 WP_001033352.1.10173 WP_001033352.1.101747 WP_001033352.1.101777 WP_001033352.1.101786 WP_001033352.1.10184 WP_001033352.1.101840 WP_001033352.1.101845 WP_001033352.1.101865 WP_001033352.1.10187 WP_001033352.1.10188 WP_001033352.1.101887 WP_001033352.1.101889 WP_001033352.1.10190 WP_001033352.1.101900 WP_001033352.1.101908 WP_001033352.1.101913 WP_001033352.1.101937 WP_001033352.1.101940 WP_001033352.1.101942 WP_001033352.1.101947 WP_001033352.1.101952 WP_001033352.1.101969 WP_001033352.1.101977 WP_001033352.1.101987 WP_001033352.1.102021 WP_001033352.1.10206 WP_001033352.1.102069 WP_001033352.1.102093 WP_001033352.1.102094 WP_001033352.1.102122 WP_001033352.1.102139 WP_001033352.1.10222 WP_001033352.1.10226 WP_001033352.1.10233 WP_001033352.1.10235 WP_001033352.1.10252 WP_001033352.1.10273 WP_001033352.1.10304 WP_001033352.1.10329 WP_001033352.1.10335 WP_001033352.1.10348 WP_001033352.1.10352 WP_001033352.1.10379 WP_001033352.1.1040 WP_001033352.1.10400 WP_001033352.1.10417 WP_001033352.1.10461 WP_001033352.1.10476 WP_001033352.1.10491 WP_001033352.1.10496 WP_001033352.1.10508 WP_001033352.1.10525 WP_001033352.1.10538 WP_001033352.1.10569 WP_001033352.1.10576 WP_001033352.1.10579 WP_001033352.1.1058 WP_001033352.1.10607 WP_001033352.1.10628 WP_001033352.1.10673 WP_001033352.1.1071 WP_001033352.1.10715 WP_001033352.1.10729 WP_001033352.1.1073 WP_001033352.1.1074 WP_001033352.1.10761 WP_001033352.1.10763 WP_001033352.1.10771 WP_001033352.1.10798 WP_001033352.1.10833 WP_001033352.1.10862 WP_001033352.1.10922 WP_001033352.1.10940 WP_001033352.1.10970 WP_001033352.1.10988 WP_001033352.1.10994 WP_001033352.1.10995 WP_001033352.1.11032 WP_001033352.1.11047 WP_001033352.1.11068 WP_001033352.1.11071 WP_001033352.1.11091 WP_001033352.1.1111 WP_001033352.1.11118 WP_001033352.1.11121 WP_001033352.1.1113 WP_001033352.1.11133 WP_001033352.1.112 WP_001033352.1.1122 WP_001033352.1.11240 WP_001033352.1.11251 WP_001033352.1.11272 WP_001033352.1.11301 WP_001033352.1.11323 WP_001033352.1.11408 WP_001033352.1.11418 WP_001033352.1.11420 WP_001033352.1.11436 WP_001033352.1.11437 WP_001033352.1.11440 WP_001033352.1.11452 WP_001033352.1.11499 WP_001033352.1.11524 WP_001033352.1.11595 WP_001033352.1.11616 WP_001033352.1.11645 WP_001033352.1.11671 WP_001033352.1.11673 WP_001033352.1.1168 WP_001033352.1.11690 WP_001033352.1.11699 WP_001033352.1.11748 WP_001033352.1.11759 WP_001033352.1.1176 WP_001033352.1.11762 WP_001033352.1.11803 WP_001033352.1.11844 WP_001033352.1.1186 WP_001033352.1.11949 WP_001033352.1.11955 WP_001033352.1.1196 WP_001033352.1.11982 WP_001033352.1.11985 WP_001033352.1.12000 WP_001033352.1.12030 WP_001033352.1.12036 WP_001033352.1.12051 WP_001033352.1.12060 WP_001033352.1.12095 WP_001033352.1.12112 WP_001033352.1.1212 WP_001033352.1.1218 WP_001033352.1.12204 WP_001033352.1.12259 WP_001033352.1.12279 WP_001033352.1.12292 WP_001033352.1.12305 WP_001033352.1.12319 WP_001033352.1.12320 WP_001033352.1.12342 WP_001033352.1.12344 WP_001033352.1.12352 WP_001033352.1.12415 WP_001033352.1.12426 WP_001033352.1.12458 WP_001033352.1.12542 WP_001033352.1.12552 WP_001033352.1.12558 WP_001033352.1.12566 WP_001033352.1.12582 WP_001033352.1.12623 WP_001033352.1.12645 WP_001033352.1.12675 WP_001033352.1.12680 WP_001033352.1.127 WP_001033352.1.12717 WP_001033352.1.12743 WP_001033352.1.12749 WP_001033352.1.12756 WP_001033352.1.12762 WP_001033352.1.12775 WP_001033352.1.1280 WP_001033352.1.12831 WP_001033352.1.12876 WP_001033352.1.12914 WP_001033352.1.1295 WP_001033352.1.12979 WP_001033352.1.12987 WP_001033352.1.13002 WP_001033352.1.13015 WP_001033352.1.13060 WP_001033352.1.13074 WP_001033352.1.1312 WP_001033352.1.13136 WP_001033352.1.1315 WP_001033352.1.13162 WP_001033352.1.13176 WP_001033352.1.13217 WP_001033352.1.13222 WP_001033352.1.13223 WP_001033352.1.13239 WP_001033352.1.13252 WP_001033352.1.13258 WP_001033352.1.13278 WP_001033352.1.13281 WP_001033352.1.13290 WP_001033352.1.13332 WP_001033352.1.13333 WP_001033352.1.13346 WP_001033352.1.1335 WP_001033352.1.13383 WP_001033352.1.13411 WP_001033352.1.13430 WP_001033352.1.13442 WP_001033352.1.1345 WP_001033352.1.13451 WP_001033352.1.13481 WP_001033352.1.13492 WP_001033352.1.13566 WP_001033352.1.13585 WP_001033352.1.13589 WP_001033352.1.13601 WP_001033352.1.13618 WP_001033352.1.13624 WP_001033352.1.13644 WP_001033352.1.13656 WP_001033352.1.13664 WP_001033352.1.13672 WP_001033352.1.13740 WP_001033352.1.13824 WP_001033352.1.13877 WP_001033352.1.13881 WP_001033352.1.13891 WP_001033352.1.13924 WP_001033352.1.13936 WP_001033352.1.13939 WP_001033352.1.13949 WP_001033352.1.13974 WP_001033352.1.13981 WP_001033352.1.14030 WP_001033352.1.14058 WP_001033352.1.14062 WP_001033352.1.14070 WP_001033352.1.14094 WP_001033352.1.14110 WP_001033352.1.14127 WP_001033352.1.14154 WP_001033352.1.1419 WP_001033352.1.14199 WP_001033352.1.142 WP_001033352.1.14277 WP_001033352.1.14292 WP_001033352.1.14299 WP_001033352.1.14304 WP_001033352.1.14346 WP_001033352.1.1438 WP_001033352.1.1439 WP_001033352.1.14398 WP_001033352.1.14417 WP_001033352.1.14451 WP_001033352.1.14468 WP_001033352.1.14493 WP_001033352.1.14499 WP_001033352.1.14501 WP_001033352.1.14508 WP_001033352.1.14529 WP_001033352.1.14582 WP_001033352.1.1461 WP_001033352.1.14621 WP_001033352.1.14648 WP_001033352.1.14661 WP_001033352.1.14672 WP_001033352.1.14687 WP_001033352.1.14693 WP_001033352.1.1470 WP_001033352.1.14711 WP_001033352.1.14748 WP_001033352.1.14811 WP_001033352.1.14833 WP_001033352.1.1486 WP_001033352.1.14861 WP_001033352.1.14871 WP_001033352.1.14879 WP_001033352.1.14958 WP_001033352.1.14965 WP_001033352.1.14977 WP_001033352.1.14992 WP_001033352.1.14993 WP_001033352.1.15007 WP_001033352.1.15041 WP_001033352.1.1508 WP_001033352.1.15087 WP_001033352.1.1510 WP_001033352.1.15117 WP_001033352.1.1512 WP_001033352.1.15121 WP_001033352.1.15138 WP_001033352.1.15148 WP_001033352.1.15177 WP_001033352.1.15191 WP_001033352.1.15193 WP_001033352.1.15207 WP_001033352.1.15221 WP_001033352.1.1524 WP_001033352.1.15245 WP_001033352.1.15252 WP_001033352.1.15259 WP_001033352.1.15270 WP_001033352.1.15277 WP_001033352.1.15282 WP_001033352.1.15287 WP_001033352.1.153 WP_001033352.1.15300 WP_001033352.1.15332 WP_001033352.1.15335 WP_001033352.1.15356 WP_001033352.1.15377 WP_001033352.1.15416 WP_001033352.1.1543 WP_001033352.1.15464 WP_001033352.1.15469 WP_001033352.1.15496 WP_001033352.1.15503 WP_001033352.1.15527 WP_001033352.1.15528 WP_001033352.1.15538 WP_001033352.1.15565 WP_001033352.1.15576 WP_001033352.1.15583 WP_001033352.1.1559 WP_001033352.1.15593 WP_001033352.1.15600 WP_001033352.1.1561 WP_001033352.1.15620 WP_001033352.1.15626 WP_001033352.1.15645 WP_001033352.1.15702 WP_001033352.1.15707 WP_001033352.1.15731 WP_001033352.1.15740 WP_001033352.1.15747 WP_001033352.1.15752 WP_001033352.1.15762 WP_001033352.1.15767 WP_001033352.1.15771 WP_001033352.1.15782 WP_001033352.1.15791 WP_001033352.1.1580 WP_001033352.1.1582 WP_001033352.1.1588 WP_001033352.1.15894 WP_001033352.1.15916 WP_001033352.1.15983 WP_001033352.1.16014 WP_001033352.1.16015 WP_001033352.1.16042 WP_001033352.1.16075 WP_001033352.1.16086 WP_001033352.1.1609 WP_001033352.1.16102 WP_001033352.1.16111 WP_001033352.1.16133 WP_001033352.1.16154 WP_001033352.1.16179 WP_001033352.1.16183 WP_001033352.1.16188 WP_001033352.1.16194 WP_001033352.1.1621 WP_001033352.1.16222 WP_001033352.1.16272 WP_001033352.1.16294 WP_001033352.1.163 WP_001033352.1.16303 WP_001033352.1.1634 WP_001033352.1.16387 WP_001033352.1.1640 WP_001033352.1.16435 WP_001033352.1.16463 WP_001033352.1.16481 WP_001033352.1.16482 WP_001033352.1.16532 WP_001033352.1.16539 WP_001033352.1.16541 WP_001033352.1.1655 WP_001033352.1.16577 WP_001033352.1.16592 WP_001033352.1.16604 WP_001033352.1.16640 WP_001033352.1.16648 WP_001033352.1.16669 WP_001033352.1.16682 WP_001033352.1.16715 WP_001033352.1.16721 WP_001033352.1.1673 WP_001033352.1.16752 WP_001033352.1.16805 WP_001033352.1.16845 WP_001033352.1.16861 WP_001033352.1.16894 WP_001033352.1.16970 WP_001033352.1.16992 WP_001033352.1.17017 WP_001033352.1.17018 WP_001033352.1.17042 WP_001033352.1.17084 WP_001033352.1.17085 WP_001033352.1.17087 WP_001033352.1.17089 WP_001033352.1.1710 WP_001033352.1.17101 WP_001033352.1.17102 WP_001033352.1.17109 WP_001033352.1.17114 WP_001033352.1.17119 WP_001033352.1.17123 WP_001033352.1.17150 WP_001033352.1.17153 WP_001033352.1.17170 WP_001033352.1.17172 WP_001033352.1.17182 WP_001033352.1.17186 WP_001033352.1.17187 WP_001033352.1.17205 WP_001033352.1.17216 WP_001033352.1.17230 WP_001033352.1.17241 WP_001033352.1.17242 WP_001033352.1.1726 WP_001033352.1.17267 WP_001033352.1.17282 WP_001033352.1.17290 WP_001033352.1.17297 WP_001033352.1.17300 WP_001033352.1.17301 WP_001033352.1.17360 WP_001033352.1.17373 WP_001033352.1.17386 WP_001033352.1.17389 WP_001033352.1.17392 WP_001033352.1.17410 WP_001033352.1.17415 WP_001033352.1.17417 WP_001033352.1.17432 WP_001033352.1.17441 WP_001033352.1.17464 WP_001033352.1.17534 WP_001033352.1.1754 WP_001033352.1.1755 WP_001033352.1.17550 WP_001033352.1.17570 WP_001033352.1.17577 WP_001033352.1.17595 WP_001033352.1.17623 WP_001033352.1.1763 WP_001033352.1.17637 WP_001033352.1.1766 WP_001033352.1.17680 WP_001033352.1.1769 WP_001033352.1.17701 WP_001033352.1.17765 WP_001033352.1.17766 WP_001033352.1.1778 WP_001033352.1.17802 WP_001033352.1.17831 WP_001033352.1.17836 WP_001033352.1.17889 WP_001033352.1.17904 WP_001033352.1.17920 WP_001033352.1.17937 WP_001033352.1.17952 WP_001033352.1.17961 WP_001033352.1.17963 WP_001033352.1.17984 WP_001033352.1.18000 WP_001033352.1.18006 WP_001033352.1.18050 WP_001033352.1.18064 WP_001033352.1.18112 WP_001033352.1.18133 WP_001033352.1.18134 WP_001033352.1.18136 WP_001033352.1.18164 WP_001033352.1.18175 WP_001033352.1.18229 WP_001033352.1.18311 WP_001033352.1.18326 WP_001033352.1.18329 WP_001033352.1.18338 WP_001033352.1.1834 WP_001033352.1.18340 WP_001033352.1.18354 WP_001033352.1.18381 WP_001033352.1.18402 WP_001033352.1.18436 WP_001033352.1.18438 WP_001033352.1.18458 WP_001033352.1.18511 WP_001033352.1.18519 WP_001033352.1.18530 WP_001033352.1.18550 WP_001033352.1.18583 WP_001033352.1.18588 WP_001033352.1.18628 WP_001033352.1.18649 WP_001033352.1.18650 WP_001033352.1.1866 WP_001033352.1.18666 WP_001033352.1.1867 WP_001033352.1.18675 WP_001033352.1.18699 WP_001033352.1.18714 WP_001033352.1.18726 WP_001033352.1.188 WP_001033352.1.18806 WP_001033352.1.1881 WP_001033352.1.18837 WP_001033352.1.18858 WP_001033352.1.18861 WP_001033352.1.18876 WP_001033352.1.18899 WP_001033352.1.18923 WP_001033352.1.18929 WP_001033352.1.18983 WP_001033352.1.18995 WP_001033352.1.1903 WP_001033352.1.19039 WP_001033352.1.1906 WP_001033352.1.19075 WP_001033352.1.1909 WP_001033352.1.191 WP_001033352.1.19113 WP_001033352.1.19114 WP_001033352.1.19122 WP_001033352.1.19140 WP_001033352.1.19147 WP_001033352.1.1915 WP_001033352.1.19150 WP_001033352.1.19194 WP_001033352.1.19205 WP_001033352.1.19277 WP_001033352.1.19297 WP_001033352.1.193 WP_001033352.1.19312 WP_001033352.1.19313 WP_001033352.1.19314 WP_001033352.1.19315 WP_001033352.1.19332 WP_001033352.1.19338 WP_001033352.1.19347 WP_001033352.1.19361 WP_001033352.1.19389 WP_001033352.1.19397 WP_001033352.1.19419 WP_001033352.1.19424 WP_001033352.1.19478 WP_001033352.1.19487 WP_001033352.1.19494 WP_001033352.1.19557 WP_001033352.1.19581 WP_001033352.1.19583 WP_001033352.1.19602 WP_001033352.1.1963 WP_001033352.1.19644 WP_001033352.1.19655 WP_001033352.1.19684 WP_001033352.1.19691 WP_001033352.1.19758 WP_001033352.1.19778 WP_001033352.1.19795 WP_001033352.1.1982 WP_001033352.1.19838 WP_001033352.1.19840 WP_001033352.1.19845 WP_001033352.1.19847 WP_001033352.1.19873 WP_001033352.1.19878 WP_001033352.1.19889 WP_001033352.1.19940 WP_001033352.1.19945 WP_001033352.1.19957 WP_001033352.1.19994 WP_001033352.1.20025 WP_001033352.1.2005 WP_001033352.1.20096 WP_001033352.1.20114 WP_001033352.1.20129 WP_001033352.1.20133 WP_001033352.1.20136 WP_001033352.1.20151 WP_001033352.1.20157 WP_001033352.1.20159 WP_001033352.1.20164 WP_001033352.1.20166 WP_001033352.1.20170 WP_001033352.1.20178 WP_001033352.1.20183 WP_001033352.1.20192 WP_001033352.1.20215 WP_001033352.1.2022 WP_001033352.1.20230 WP_001033352.1.20251 WP_001033352.1.20264 WP_001033352.1.20290 WP_001033352.1.20308 WP_001033352.1.20318 WP_001033352.1.20325 WP_001033352.1.20331 WP_001033352.1.20334 WP_001033352.1.20370 WP_001033352.1.20445 WP_001033352.1.20449 WP_001033352.1.20519 WP_001033352.1.20546 WP_001033352.1.20594 WP_001033352.1.20596 WP_001033352.1.2063 WP_001033352.1.20630 WP_001033352.1.20636 WP_001033352.1.20638 WP_001033352.1.20662 WP_001033352.1.20668 WP_001033352.1.20691 WP_001033352.1.20724 WP_001033352.1.20730 WP_001033352.1.20737 WP_001033352.1.20745 WP_001033352.1.20765 WP_001033352.1.20785 WP_001033352.1.20813 WP_001033352.1.20831 WP_001033352.1.20848 WP_001033352.1.20893 WP_001033352.1.2093 WP_001033352.1.2094 WP_001033352.1.20941 WP_001033352.1.20943 WP_001033352.1.20950 WP_001033352.1.20958 WP_001033352.1.20982 WP_001033352.1.20989 WP_001033352.1.2100 WP_001033352.1.21017 WP_001033352.1.21020 WP_001033352.1.21022 WP_001033352.1.21029 WP_001033352.1.21033 WP_001033352.1.21041 WP_001033352.1.21057 WP_001033352.1.21059 WP_001033352.1.21104 WP_001033352.1.21122 WP_001033352.1.21129 WP_001033352.1.2113 WP_001033352.1.21131 WP_001033352.1.21137 WP_001033352.1.21171 WP_001033352.1.21197 WP_001033352.1.21251 WP_001033352.1.21277 WP_001033352.1.21305 WP_001033352.1.21320 WP_001033352.1.21336 WP_001033352.1.2142 WP_001033352.1.21470 WP_001033352.1.21508 WP_001033352.1.21519 WP_001033352.1.2156 WP_001033352.1.21573 WP_001033352.1.21578 WP_001033352.1.21596 WP_001033352.1.21628 WP_001033352.1.21637 WP_001033352.1.2164 WP_001033352.1.21656 WP_001033352.1.21661 WP_001033352.1.21666 WP_001033352.1.21667 WP_001033352.1.21668 WP_001033352.1.21673 WP_001033352.1.21696 WP_001033352.1.21727 WP_001033352.1.21733 WP_001033352.1.21756 WP_001033352.1.21758 WP_001033352.1.21762 WP_001033352.1.21771 WP_001033352.1.21811 WP_001033352.1.21812 WP_001033352.1.21823 WP_001033352.1.21887 WP_001033352.1.21915 WP_001033352.1.21945 WP_001033352.1.21948 WP_001033352.1.21962 WP_001033352.1.22060 WP_001033352.1.22098 WP_001033352.1.22113 WP_001033352.1.22138 WP_001033352.1.22195 WP_001033352.1.22251 WP_001033352.1.22268 WP_001033352.1.22269 WP_001033352.1.22291 WP_001033352.1.22295 WP_001033352.1.22304 WP_001033352.1.22314 WP_001033352.1.2232 WP_001033352.1.22325 WP_001033352.1.22328 WP_001033352.1.22350 WP_001033352.1.22359 WP_001033352.1.22381 WP_001033352.1.22450 WP_001033352.1.22470 WP_001033352.1.22494 WP_001033352.1.22501 WP_001033352.1.22544 WP_001033352.1.22571 WP_001033352.1.22572 WP_001033352.1.22574 WP_001033352.1.22579 WP_001033352.1.22594 WP_001033352.1.22631 WP_001033352.1.22632 WP_001033352.1.22641 WP_001033352.1.22649 WP_001033352.1.22662 WP_001033352.1.22669 WP_001033352.1.22756 WP_001033352.1.22765 WP_001033352.1.22783 WP_001033352.1.22809 WP_001033352.1.22827 WP_001033352.1.22830 WP_001033352.1.22846 WP_001033352.1.22868 WP_001033352.1.22875 WP_001033352.1.22878 WP_001033352.1.22885 WP_001033352.1.22908 WP_001033352.1.22925 WP_001033352.1.22990 WP_001033352.1.2300 WP_001033352.1.23005 WP_001033352.1.23026 WP_001033352.1.23035 WP_001033352.1.23044 WP_001033352.1.23045 WP_001033352.1.23057 WP_001033352.1.23062 WP_001033352.1.23073 WP_001033352.1.23078 WP_001033352.1.23081 WP_001033352.1.23090 WP_001033352.1.23105 WP_001033352.1.23115 WP_001033352.1.23120 WP_001033352.1.23135 WP_001033352.1.23241 WP_001033352.1.23257 WP_001033352.1.23270 WP_001033352.1.23285 WP_001033352.1.23290 WP_001033352.1.23293 WP_001033352.1.23299 WP_001033352.1.23323 WP_001033352.1.23351 WP_001033352.1.23352 WP_001033352.1.23376 WP_001033352.1.23378 WP_001033352.1.23383 WP_001033352.1.23388 WP_001033352.1.23393 WP_001033352.1.23443 WP_001033352.1.23456 WP_001033352.1.23463 WP_001033352.1.23467 WP_001033352.1.23486 WP_001033352.1.23487 WP_001033352.1.23511 WP_001033352.1.23520 WP_001033352.1.23527 WP_001033352.1.2353 WP_001033352.1.23549 WP_001033352.1.23554 WP_001033352.1.23561 WP_001033352.1.23563 WP_001033352.1.23584 WP_001033352.1.23593 WP_001033352.1.23640 WP_001033352.1.23660 WP_001033352.1.23676 WP_001033352.1.23693 WP_001033352.1.23729 WP_001033352.1.23741 WP_001033352.1.23754 WP_001033352.1.23765 WP_001033352.1.23790 WP_001033352.1.23795 WP_001033352.1.23812 WP_001033352.1.23838 WP_001033352.1.2388 WP_001033352.1.23881 WP_001033352.1.23886 WP_001033352.1.23898 WP_001033352.1.23899 WP_001033352.1.23914 WP_001033352.1.23915 WP_001033352.1.23931 WP_001033352.1.23945 WP_001033352.1.23950 WP_001033352.1.23970 WP_001033352.1.23971 WP_001033352.1.23973 WP_001033352.1.23984 WP_001033352.1.24 WP_001033352.1.24024 WP_001033352.1.24045 WP_001033352.1.24051 WP_001033352.1.24058 WP_001033352.1.24068 WP_001033352.1.24070 WP_001033352.1.24089 WP_001033352.1.24120 WP_001033352.1.24122 WP_001033352.1.24124 WP_001033352.1.24136 WP_001033352.1.2418 WP_001033352.1.24194 WP_001033352.1.24233 WP_001033352.1.2428 WP_001033352.1.24283 WP_001033352.1.24290 WP_001033352.1.2430 WP_001033352.1.24304 WP_001033352.1.24316 WP_001033352.1.24341 WP_001033352.1.24362 WP_001033352.1.2437 WP_001033352.1.24374 WP_001033352.1.24381 WP_001033352.1.24485 WP_001033352.1.24499 WP_001033352.1.24533 WP_001033352.1.24536 WP_001033352.1.2456 WP_001033352.1.24560 WP_001033352.1.24570 WP_001033352.1.24575 WP_001033352.1.24583 WP_001033352.1.24616 WP_001033352.1.24634 WP_001033352.1.24641 WP_001033352.1.24646 WP_001033352.1.24650 WP_001033352.1.24695 WP_001033352.1.24783 WP_001033352.1.24791 WP_001033352.1.24799 WP_001033352.1.24849 WP_001033352.1.24854 WP_001033352.1.24870 WP_001033352.1.24899 WP_001033352.1.24929 WP_001033352.1.24939 WP_001033352.1.24946 WP_001033352.1.24960 WP_001033352.1.24981 WP_001033352.1.24982 WP_001033352.1.24984 WP_001033352.1.25019 WP_001033352.1.25039 WP_001033352.1.25050 WP_001033352.1.25060 WP_001033352.1.25076 WP_001033352.1.25082 WP_001033352.1.25085 WP_001033352.1.25086 WP_001033352.1.25087 WP_001033352.1.25088 WP_001033352.1.25126 WP_001033352.1.25141 WP_001033352.1.25183 WP_001033352.1.25201 WP_001033352.1.25203 WP_001033352.1.25289 WP_001033352.1.25305 WP_001033352.1.2531 WP_001033352.1.25312 WP_001033352.1.25324 WP_001033352.1.25346 WP_001033352.1.2537 WP_001033352.1.25378 WP_001033352.1.254 WP_001033352.1.25403 WP_001033352.1.25414 WP_001033352.1.2543 WP_001033352.1.255 WP_001033352.1.25517 WP_001033352.1.25548 WP_001033352.1.25577 WP_001033352.1.2558 WP_001033352.1.25592 WP_001033352.1.25598 WP_001033352.1.25602 WP_001033352.1.25613 WP_001033352.1.25652 WP_001033352.1.25713 WP_001033352.1.25717 WP_001033352.1.25718 WP_001033352.1.25726 WP_001033352.1.25753 WP_001033352.1.25755 WP_001033352.1.25794 WP_001033352.1.25819 WP_001033352.1.25831 WP_001033352.1.25832 WP_001033352.1.25843 WP_001033352.1.25855 WP_001033352.1.2588 WP_001033352.1.25886 WP_001033352.1.2589 WP_001033352.1.25915 WP_001033352.1.25945 WP_001033352.1.25996 WP_001033352.1.26048 WP_001033352.1.26055 WP_001033352.1.26066 WP_001033352.1.26105 WP_001033352.1.2612 WP_001033352.1.26121 WP_001033352.1.26134 WP_001033352.1.26135 WP_001033352.1.26161 WP_001033352.1.26186 WP_001033352.1.26191 WP_001033352.1.26246 WP_001033352.1.26264 WP_001033352.1.26270 WP_001033352.1.26331 WP_001033352.1.2637 WP_001033352.1.26379 WP_001033352.1.26391 WP_001033352.1.26401 WP_001033352.1.26403 WP_001033352.1.2642 WP_001033352.1.26467 WP_001033352.1.26474 WP_001033352.1.26479 WP_001033352.1.26480 WP_001033352.1.26517 WP_001033352.1.26525 WP_001033352.1.26569 WP_001033352.1.26570 WP_001033352.1.26575 WP_001033352.1.26588 WP_001033352.1.26590 WP_001033352.1.26598 WP_001033352.1.26609 WP_001033352.1.26613 WP_001033352.1.26644 WP_001033352.1.26683 WP_001033352.1.26720 WP_001033352.1.26736 WP_001033352.1.26761 WP_001033352.1.26766 WP_001033352.1.26878 WP_001033352.1.2694 WP_001033352.1.26941 WP_001033352.1.26943 WP_001033352.1.26975 WP_001033352.1.26998 WP_001033352.1.27019 WP_001033352.1.27057 WP_001033352.1.27060 WP_001033352.1.27098 WP_001033352.1.27105 WP_001033352.1.2712 WP_001033352.1.27134 WP_001033352.1.27141 WP_001033352.1.27148 WP_001033352.1.27175 WP_001033352.1.27214 WP_001033352.1.27234 WP_001033352.1.27260 WP_001033352.1.27280 WP_001033352.1.27283 WP_001033352.1.27287 WP_001033352.1.2731 WP_001033352.1.27338 WP_001033352.1.27367 WP_001033352.1.27373 WP_001033352.1.27424 WP_001033352.1.27445 WP_001033352.1.27451 WP_001033352.1.27504 WP_001033352.1.2755 WP_001033352.1.27560 WP_001033352.1.27580 WP_001033352.1.27611 WP_001033352.1.27683 WP_001033352.1.27698 WP_001033352.1.27723 WP_001033352.1.27734 WP_001033352.1.27741 WP_001033352.1.27742 WP_001033352.1.27749 WP_001033352.1.27758 WP_001033352.1.27774 WP_001033352.1.27786 WP_001033352.1.27856 WP_001033352.1.27876 WP_001033352.1.27879 WP_001033352.1.27897 WP_001033352.1.27923 WP_001033352.1.27957 WP_001033352.1.27971 WP_001033352.1.28109 WP_001033352.1.2811 WP_001033352.1.28128 WP_001033352.1.28143 WP_001033352.1.28168 WP_001033352.1.2823 WP_001033352.1.28250 WP_001033352.1.2826 WP_001033352.1.28268 WP_001033352.1.28271 WP_001033352.1.28305 WP_001033352.1.28401 WP_001033352.1.28414 WP_001033352.1.28433 WP_001033352.1.28440 WP_001033352.1.28480 WP_001033352.1.28496 WP_001033352.1.28509 WP_001033352.1.28523 WP_001033352.1.28540 WP_001033352.1.28551 WP_001033352.1.28662 WP_001033352.1.28683 WP_001033352.1.28697 WP_001033352.1.28711 WP_001033352.1.28734 WP_001033352.1.28760 WP_001033352.1.28769 WP_001033352.1.28791 WP_001033352.1.28809 WP_001033352.1.2881 WP_001033352.1.28835 WP_001033352.1.28863 WP_001033352.1.28879 WP_001033352.1.28919 WP_001033352.1.28950 WP_001033352.1.28953 WP_001033352.1.28982 WP_001033352.1.28994 WP_001033352.1.290 WP_001033352.1.29016 WP_001033352.1.29026 WP_001033352.1.29055 WP_001033352.1.29061 WP_001033352.1.29079 WP_001033352.1.29082 WP_001033352.1.291 WP_001033352.1.29100 WP_001033352.1.29118 WP_001033352.1.29125 WP_001033352.1.29126 WP_001033352.1.29128 WP_001033352.1.29146 WP_001033352.1.29150 WP_001033352.1.29176 WP_001033352.1.29197 WP_001033352.1.29202 WP_001033352.1.29221 WP_001033352.1.29239 WP_001033352.1.29252 WP_001033352.1.2926 WP_001033352.1.29404 WP_001033352.1.2942 WP_001033352.1.29429 WP_001033352.1.2945 WP_001033352.1.29495 WP_001033352.1.29504 WP_001033352.1.2952 WP_001033352.1.29556 WP_001033352.1.29564 WP_001033352.1.29590 WP_001033352.1.29597 WP_001033352.1.29618 WP_001033352.1.29643 WP_001033352.1.29669 WP_001033352.1.29683 WP_001033352.1.29689 WP_001033352.1.29699 WP_001033352.1.29715 WP_001033352.1.29724 WP_001033352.1.29740 WP_001033352.1.29746 WP_001033352.1.29752 WP_001033352.1.2978 WP_001033352.1.29840 WP_001033352.1.2986 WP_001033352.1.29874 WP_001033352.1.29876 WP_001033352.1.29933 WP_001033352.1.2995 WP_001033352.1.29967 WP_001033352.1.29976 WP_001033352.1.29992 WP_001033352.1.30004 WP_001033352.1.30019 WP_001033352.1.30035 WP_001033352.1.30052 WP_001033352.1.30064 WP_001033352.1.30098 WP_001033352.1.30105 WP_001033352.1.30123 WP_001033352.1.30141 WP_001033352.1.30164 WP_001033352.1.30221 WP_001033352.1.30231 WP_001033352.1.30247 WP_001033352.1.30253 WP_001033352.1.30347 WP_001033352.1.30391 WP_001033352.1.30399 WP_001033352.1.30401 WP_001033352.1.30428 WP_001033352.1.3045 WP_001033352.1.30452 WP_001033352.1.30472 WP_001033352.1.30476 WP_001033352.1.30479 WP_001033352.1.30497 WP_001033352.1.30546 WP_001033352.1.30554 WP_001033352.1.30580 WP_001033352.1.3063 WP_001033352.1.30630 WP_001033352.1.30637 WP_001033352.1.30639 WP_001033352.1.30700 WP_001033352.1.30733 WP_001033352.1.30749 WP_001033352.1.30783 WP_001033352.1.30843 WP_001033352.1.30853 WP_001033352.1.30906 WP_001033352.1.30918 WP_001033352.1.30960 WP_001033352.1.30993 WP_001033352.1.30999 WP_001033352.1.31000 WP_001033352.1.31009 WP_001033352.1.31026 WP_001033352.1.31055 WP_001033352.1.31089 WP_001033352.1.31142 WP_001033352.1.31154 WP_001033352.1.31211 WP_001033352.1.31252 WP_001033352.1.31319 WP_001033352.1.31340 WP_001033352.1.31347 WP_001033352.1.31353 WP_001033352.1.31357 WP_001033352.1.31379 WP_001033352.1.3140 WP_001033352.1.31401 WP_001033352.1.31407 WP_001033352.1.31419 WP_001033352.1.31421 WP_001033352.1.31429 WP_001033352.1.31431 WP_001033352.1.31434 WP_001033352.1.31482 WP_001033352.1.31506 WP_001033352.1.31518 WP_001033352.1.31521 WP_001033352.1.31527 WP_001033352.1.31575 WP_001033352.1.31614 WP_001033352.1.31618 WP_001033352.1.31625 WP_001033352.1.31639 WP_001033352.1.31679 WP_001033352.1.31681 WP_001033352.1.3169 WP_001033352.1.31696 WP_001033352.1.31715 WP_001033352.1.31736 WP_001033352.1.31740 WP_001033352.1.31801 WP_001033352.1.31803 WP_001033352.1.3181 WP_001033352.1.31833 WP_001033352.1.31839 WP_001033352.1.31860 WP_001033352.1.31866 WP_001033352.1.31898 WP_001033352.1.31899 WP_001033352.1.31903 WP_001033352.1.31924 WP_001033352.1.31928 WP_001033352.1.3193 WP_001033352.1.31937 WP_001033352.1.31956 WP_001033352.1.31978 WP_001033352.1.32037 WP_001033352.1.32049 WP_001033352.1.32063 WP_001033352.1.32078 WP_001033352.1.32091 WP_001033352.1.3212 WP_001033352.1.32121 WP_001033352.1.32127 WP_001033352.1.32142 WP_001033352.1.32143 WP_001033352.1.32173 WP_001033352.1.32184 WP_001033352.1.322 WP_001033352.1.32222 WP_001033352.1.32232 WP_001033352.1.32234 WP_001033352.1.32236 WP_001033352.1.32242 WP_001033352.1.32243 WP_001033352.1.32279 WP_001033352.1.32287 WP_001033352.1.32333 WP_001033352.1.32394 WP_001033352.1.32406 WP_001033352.1.32435 WP_001033352.1.3247 WP_001033352.1.32475 WP_001033352.1.32479 WP_001033352.1.3248 WP_001033352.1.32494 WP_001033352.1.32509 WP_001033352.1.32536 WP_001033352.1.32561 WP_001033352.1.32574 WP_001033352.1.32580 WP_001033352.1.32590 WP_001033352.1.32591 WP_001033352.1.32601 WP_001033352.1.32635 WP_001033352.1.32655 WP_001033352.1.32661 WP_001033352.1.32680 WP_001033352.1.327 WP_001033352.1.32709 WP_001033352.1.32715 WP_001033352.1.32720 WP_001033352.1.32722 WP_001033352.1.32724 WP_001033352.1.32741 WP_001033352.1.32815 WP_001033352.1.32831 WP_001033352.1.32875 WP_001033352.1.32888 WP_001033352.1.32903 WP_001033352.1.32931 WP_001033352.1.32946 WP_001033352.1.3295 WP_001033352.1.32959 WP_001033352.1.32972 WP_001033352.1.32984 WP_001033352.1.32992 WP_001033352.1.32995 WP_001033352.1.33004 WP_001033352.1.33014 WP_001033352.1.33022 WP_001033352.1.33049 WP_001033352.1.33053 WP_001033352.1.33055 WP_001033352.1.33094 WP_001033352.1.33119 WP_001033352.1.33125 WP_001033352.1.33146 WP_001033352.1.33167 WP_001033352.1.33171 WP_001033352.1.33178 WP_001033352.1.3323 WP_001033352.1.33237 WP_001033352.1.33238 WP_001033352.1.33244 WP_001033352.1.33268 WP_001033352.1.33325 WP_001033352.1.33341 WP_001033352.1.33362 WP_001033352.1.33385 WP_001033352.1.334 WP_001033352.1.33408 WP_001033352.1.33413 WP_001033352.1.33422 WP_001033352.1.33424 WP_001033352.1.33475 WP_001033352.1.33476 WP_001033352.1.33502 WP_001033352.1.33526 WP_001033352.1.3354 WP_001033352.1.33545 WP_001033352.1.33561 WP_001033352.1.33631 WP_001033352.1.33638 WP_001033352.1.33648 WP_001033352.1.33667 WP_001033352.1.33680 WP_001033352.1.33729 WP_001033352.1.33736 WP_001033352.1.33746 WP_001033352.1.33751 WP_001033352.1.33780 WP_001033352.1.33799 WP_001033352.1.33823 WP_001033352.1.33853 WP_001033352.1.33854 WP_001033352.1.33879 WP_001033352.1.33888 WP_001033352.1.33914 WP_001033352.1.33948 WP_001033352.1.33952 WP_001033352.1.33979 WP_001033352.1.3398 WP_001033352.1.33981 WP_001033352.1.34003 WP_001033352.1.3401 WP_001033352.1.34094 WP_001033352.1.3411 WP_001033352.1.34122 WP_001033352.1.34124 WP_001033352.1.3415 WP_001033352.1.342 WP_001033352.1.34206 WP_001033352.1.34224 WP_001033352.1.34269 WP_001033352.1.34270 WP_001033352.1.34273 WP_001033352.1.34277 WP_001033352.1.34332 WP_001033352.1.34341 WP_001033352.1.34363 WP_001033352.1.34380 WP_001033352.1.34383 WP_001033352.1.3439 WP_001033352.1.34397 WP_001033352.1.34440 WP_001033352.1.34444 WP_001033352.1.34464 WP_001033352.1.34500 WP_001033352.1.34525 WP_001033352.1.34532 WP_001033352.1.34538 WP_001033352.1.34541 WP_001033352.1.34557 WP_001033352.1.34605 WP_001033352.1.34655 WP_001033352.1.34668 WP_001033352.1.34680 WP_001033352.1.34682 WP_001033352.1.34686 WP_001033352.1.347 WP_001033352.1.34727 WP_001033352.1.34781 WP_001033352.1.34782 WP_001033352.1.34794 WP_001033352.1.34827 WP_001033352.1.34948 WP_001033352.1.34983 WP_001033352.1.34990 WP_001033352.1.34993 WP_001033352.1.35114 WP_001033352.1.3515 WP_001033352.1.35180 WP_001033352.1.35186 WP_001033352.1.35195 WP_001033352.1.35204 WP_001033352.1.3521 WP_001033352.1.35211 WP_001033352.1.35316 WP_001033352.1.35349 WP_001033352.1.35360 WP_001033352.1.35365 WP_001033352.1.35376 WP_001033352.1.3539 WP_001033352.1.35393 WP_001033352.1.35398 WP_001033352.1.35464 WP_001033352.1.35465 WP_001033352.1.35466 WP_001033352.1.35468 WP_001033352.1.3550 WP_001033352.1.35552 WP_001033352.1.3560 WP_001033352.1.35651 WP_001033352.1.35653 WP_001033352.1.35654 WP_001033352.1.35698 WP_001033352.1.35704 WP_001033352.1.35724 WP_001033352.1.35740 WP_001033352.1.35904 WP_001033352.1.35922 WP_001033352.1.35927 WP_001033352.1.35934 WP_001033352.1.35942 WP_001033352.1.35959 WP_001033352.1.35983 WP_001033352.1.36040 WP_001033352.1.36042 WP_001033352.1.36070 WP_001033352.1.36071 WP_001033352.1.36085 WP_001033352.1.36094 WP_001033352.1.36159 WP_001033352.1.36164 WP_001033352.1.36166 WP_001033352.1.36177 WP_001033352.1.36182 WP_001033352.1.3620 WP_001033352.1.36212 WP_001033352.1.36281 WP_001033352.1.36299 WP_001033352.1.36332 WP_001033352.1.36334 WP_001033352.1.36386 WP_001033352.1.36426 WP_001033352.1.36453 WP_001033352.1.36496 WP_001033352.1.36507 WP_001033352.1.36523 WP_001033352.1.36531 WP_001033352.1.36537 WP_001033352.1.36610 WP_001033352.1.36626 WP_001033352.1.36707 WP_001033352.1.3671 WP_001033352.1.36739 WP_001033352.1.36746 WP_001033352.1.36747 WP_001033352.1.36767 WP_001033352.1.36806 WP_001033352.1.36812 WP_001033352.1.36817 WP_001033352.1.36826 WP_001033352.1.36833 WP_001033352.1.36971 WP_001033352.1.36975 WP_001033352.1.37006 WP_001033352.1.37020 WP_001033352.1.37046 WP_001033352.1.37057 WP_001033352.1.37076 WP_001033352.1.37099 WP_001033352.1.37101 WP_001033352.1.37102 WP_001033352.1.37146 WP_001033352.1.3723 WP_001033352.1.37233 WP_001033352.1.37252 WP_001033352.1.37261 WP_001033352.1.3730 WP_001033352.1.37329 WP_001033352.1.37334 WP_001033352.1.37337 WP_001033352.1.37352 WP_001033352.1.37371 WP_001033352.1.37372 WP_001033352.1.37419 WP_001033352.1.37433 WP_001033352.1.37445 WP_001033352.1.37472 WP_001033352.1.37476 WP_001033352.1.37485 WP_001033352.1.3749 WP_001033352.1.37510 WP_001033352.1.37543 WP_001033352.1.37576 WP_001033352.1.37588 WP_001033352.1.3762 WP_001033352.1.37634 WP_001033352.1.377 WP_001033352.1.3772 WP_001033352.1.37731 WP_001033352.1.37745 WP_001033352.1.37750 WP_001033352.1.37758 WP_001033352.1.37762 WP_001033352.1.37766 WP_001033352.1.37769 WP_001033352.1.37773 WP_001033352.1.37817 WP_001033352.1.37830 WP_001033352.1.37847 WP_001033352.1.37852 WP_001033352.1.3788 WP_001033352.1.37880 WP_001033352.1.37887 WP_001033352.1.37897 WP_001033352.1.37917 WP_001033352.1.37940 WP_001033352.1.37964 WP_001033352.1.37995 WP_001033352.1.38033 WP_001033352.1.38050 WP_001033352.1.38063 WP_001033352.1.38080 WP_001033352.1.38081 WP_001033352.1.38085 WP_001033352.1.38103 WP_001033352.1.38105 WP_001033352.1.38107 WP_001033352.1.3811 WP_001033352.1.38120 WP_001033352.1.3815 WP_001033352.1.38155 WP_001033352.1.38182 WP_001033352.1.38211 WP_001033352.1.3822 WP_001033352.1.38264 WP_001033352.1.38323 WP_001033352.1.38357 WP_001033352.1.38363 WP_001033352.1.38369 WP_001033352.1.38371 WP_001033352.1.38392 WP_001033352.1.38419 WP_001033352.1.38485 WP_001033352.1.38544 WP_001033352.1.38584 WP_001033352.1.38610 WP_001033352.1.38626 WP_001033352.1.38629 WP_001033352.1.38636 WP_001033352.1.38694 WP_001033352.1.38722 WP_001033352.1.3873 WP_001033352.1.38777 WP_001033352.1.38827 WP_001033352.1.38835 WP_001033352.1.38843 WP_001033352.1.38896 WP_001033352.1.389 WP_001033352.1.38911 WP_001033352.1.38920 WP_001033352.1.38935 WP_001033352.1.38950 WP_001033352.1.38956 WP_001033352.1.38958 WP_001033352.1.39005 WP_001033352.1.39015 WP_001033352.1.3903 WP_001033352.1.39037 WP_001033352.1.39042 WP_001033352.1.39103 WP_001033352.1.39111 WP_001033352.1.39123 WP_001033352.1.39150 WP_001033352.1.39155 WP_001033352.1.39157 WP_001033352.1.39164 WP_001033352.1.39167 WP_001033352.1.39171 WP_001033352.1.39180 WP_001033352.1.3921 WP_001033352.1.39249 WP_001033352.1.39268 WP_001033352.1.39286 WP_001033352.1.39302 WP_001033352.1.39305 WP_001033352.1.39310 WP_001033352.1.39342 WP_001033352.1.39356 WP_001033352.1.39365 WP_001033352.1.39367 WP_001033352.1.39373 WP_001033352.1.39415 WP_001033352.1.39430 WP_001033352.1.39468 WP_001033352.1.39481 WP_001033352.1.39509 WP_001033352.1.39531 WP_001033352.1.39564 WP_001033352.1.39580 WP_001033352.1.39594 WP_001033352.1.39601 WP_001033352.1.39606 WP_001033352.1.39610 WP_001033352.1.39636 WP_001033352.1.39646 WP_001033352.1.39690 WP_001033352.1.3970 WP_001033352.1.39715 WP_001033352.1.39730 WP_001033352.1.39758 WP_001033352.1.39780 WP_001033352.1.3980 WP_001033352.1.39820 WP_001033352.1.39822 WP_001033352.1.39829 WP_001033352.1.39870 WP_001033352.1.39938 WP_001033352.1.39961 WP_001033352.1.39966 WP_001033352.1.39970 WP_001033352.1.39992 WP_001033352.1.39998 WP_001033352.1.40013 WP_001033352.1.40016 WP_001033352.1.40088 WP_001033352.1.40113 WP_001033352.1.40121 WP_001033352.1.40147 WP_001033352.1.40159 WP_001033352.1.40183 WP_001033352.1.40192 WP_001033352.1.4020 WP_001033352.1.40206 WP_001033352.1.40212 WP_001033352.1.40218 WP_001033352.1.40234 WP_001033352.1.40238 WP_001033352.1.40249 WP_001033352.1.40298 WP_001033352.1.4030 WP_001033352.1.40317 WP_001033352.1.40382 WP_001033352.1.40389 WP_001033352.1.40391 WP_001033352.1.40445 WP_001033352.1.4049 WP_001033352.1.40499 WP_001033352.1.40502 WP_001033352.1.40509 WP_001033352.1.40524 WP_001033352.1.40548 WP_001033352.1.40549 WP_001033352.1.40596 WP_001033352.1.406 WP_001033352.1.40617 WP_001033352.1.40623 WP_001033352.1.40629 WP_001033352.1.40666 WP_001033352.1.40668 WP_001033352.1.40686 WP_001033352.1.40712 WP_001033352.1.40742 WP_001033352.1.40758 WP_001033352.1.40781 WP_001033352.1.40793 WP_001033352.1.4081 WP_001033352.1.40813 WP_001033352.1.40815 WP_001033352.1.40882 WP_001033352.1.40898 WP_001033352.1.40900 WP_001033352.1.40912 WP_001033352.1.40937 WP_001033352.1.40952 WP_001033352.1.40965 WP_001033352.1.4103 WP_001033352.1.41045 WP_001033352.1.41060 WP_001033352.1.41125 WP_001033352.1.41147 WP_001033352.1.41206 WP_001033352.1.41230 WP_001033352.1.41239 WP_001033352.1.41259 WP_001033352.1.4126 WP_001033352.1.41287 WP_001033352.1.41330 WP_001033352.1.41346 WP_001033352.1.41363 WP_001033352.1.41368 WP_001033352.1.41371 WP_001033352.1.41372 WP_001033352.1.41392 WP_001033352.1.41402 WP_001033352.1.41417 WP_001033352.1.4142 WP_001033352.1.41436 WP_001033352.1.41455 WP_001033352.1.41457 WP_001033352.1.41466 WP_001033352.1.41479 WP_001033352.1.41484 WP_001033352.1.41530 WP_001033352.1.41536 WP_001033352.1.41545 WP_001033352.1.41556 WP_001033352.1.41566 WP_001033352.1.41606 WP_001033352.1.41613 WP_001033352.1.41621 WP_001033352.1.41651 WP_001033352.1.41654 WP_001033352.1.41712 WP_001033352.1.41718 WP_001033352.1.4172 WP_001033352.1.41734 WP_001033352.1.41740 WP_001033352.1.41752 WP_001033352.1.41778 WP_001033352.1.41780 WP_001033352.1.41782 WP_001033352.1.41784 WP_001033352.1.41812 WP_001033352.1.41813 WP_001033352.1.41826 WP_001033352.1.41849 WP_001033352.1.41900 WP_001033352.1.41960 WP_001033352.1.41964 WP_001033352.1.41988 WP_001033352.1.42022 WP_001033352.1.42027 WP_001033352.1.42036 WP_001033352.1.42060 WP_001033352.1.42073 WP_001033352.1.42095 WP_001033352.1.42096 WP_001033352.1.42113 WP_001033352.1.4213 WP_001033352.1.42138 WP_001033352.1.4214 WP_001033352.1.42159 WP_001033352.1.42179 WP_001033352.1.42203 WP_001033352.1.42209 WP_001033352.1.42214 WP_001033352.1.42226 WP_001033352.1.42233 WP_001033352.1.4224 WP_001033352.1.42252 WP_001033352.1.42277 WP_001033352.1.42300 WP_001033352.1.42318 WP_001033352.1.42359 WP_001033352.1.42367 WP_001033352.1.42369 WP_001033352.1.42376 WP_001033352.1.42387 WP_001033352.1.42415 WP_001033352.1.4242 WP_001033352.1.42432 WP_001033352.1.42442 WP_001033352.1.42447 WP_001033352.1.42456 WP_001033352.1.42480 WP_001033352.1.4250 WP_001033352.1.42513 WP_001033352.1.42522 WP_001033352.1.42547 WP_001033352.1.42594 WP_001033352.1.42632 WP_001033352.1.42661 WP_001033352.1.42669 WP_001033352.1.42728 WP_001033352.1.42748 WP_001033352.1.42749 WP_001033352.1.42750 WP_001033352.1.42761 WP_001033352.1.42770 WP_001033352.1.42771 WP_001033352.1.42791 WP_001033352.1.42813 WP_001033352.1.4282 WP_001033352.1.42828 WP_001033352.1.42830 WP_001033352.1.42832 WP_001033352.1.42863 WP_001033352.1.42879 WP_001033352.1.4290 WP_001033352.1.42918 WP_001033352.1.42936 WP_001033352.1.42937 WP_001033352.1.42950 WP_001033352.1.42962 WP_001033352.1.42966 WP_001033352.1.42975 WP_001033352.1.42987 WP_001033352.1.43035 WP_001033352.1.4306 WP_001033352.1.43079 WP_001033352.1.43121 WP_001033352.1.4313 WP_001033352.1.43132 WP_001033352.1.43133 WP_001033352.1.43137 WP_001033352.1.43140 WP_001033352.1.43166 WP_001033352.1.43174 WP_001033352.1.43177 WP_001033352.1.43196 WP_001033352.1.43270 WP_001033352.1.43316 WP_001033352.1.43324 WP_001033352.1.43363 WP_001033352.1.43374 WP_001033352.1.43384 WP_001033352.1.4342 WP_001033352.1.43444 WP_001033352.1.43448 WP_001033352.1.43455 WP_001033352.1.43469 WP_001033352.1.43473 WP_001033352.1.43474 WP_001033352.1.43489 WP_001033352.1.43536 WP_001033352.1.43566 WP_001033352.1.43598 WP_001033352.1.43604 WP_001033352.1.43720 WP_001033352.1.43750 WP_001033352.1.43754 WP_001033352.1.43769 WP_001033352.1.43798 WP_001033352.1.43804 WP_001033352.1.43816 WP_001033352.1.43837 WP_001033352.1.43858 WP_001033352.1.43911 WP_001033352.1.43925 WP_001033352.1.43939 WP_001033352.1.43989 WP_001033352.1.4400 WP_001033352.1.44018 WP_001033352.1.44020 WP_001033352.1.44029 WP_001033352.1.44040 WP_001033352.1.44075 WP_001033352.1.44077 WP_001033352.1.44096 WP_001033352.1.4411 WP_001033352.1.44115 WP_001033352.1.44125 WP_001033352.1.4415 WP_001033352.1.44162 WP_001033352.1.44166 WP_001033352.1.44201 WP_001033352.1.44203 WP_001033352.1.44238 WP_001033352.1.44264 WP_001033352.1.44273 WP_001033352.1.44287 WP_001033352.1.44292 WP_001033352.1.44314 WP_001033352.1.44324 WP_001033352.1.44365 WP_001033352.1.44389 WP_001033352.1.44424 WP_001033352.1.44426 WP_001033352.1.44445 WP_001033352.1.44458 WP_001033352.1.44461 WP_001033352.1.44488 WP_001033352.1.4449 WP_001033352.1.44524 WP_001033352.1.44539 WP_001033352.1.44561 WP_001033352.1.44570 WP_001033352.1.44587 WP_001033352.1.44608 WP_001033352.1.44610 WP_001033352.1.44661 WP_001033352.1.44686 WP_001033352.1.44724 WP_001033352.1.4473 WP_001033352.1.44733 WP_001033352.1.448 WP_001033352.1.44814 WP_001033352.1.44818 WP_001033352.1.44821 WP_001033352.1.44841 WP_001033352.1.44848 WP_001033352.1.44849 WP_001033352.1.44854 WP_001033352.1.44857 WP_001033352.1.44906 WP_001033352.1.44923 WP_001033352.1.44954 WP_001033352.1.44960 WP_001033352.1.44961 WP_001033352.1.44970 WP_001033352.1.44980 WP_001033352.1.45000 WP_001033352.1.45020 WP_001033352.1.45025 WP_001033352.1.45028 WP_001033352.1.45043 WP_001033352.1.45068 WP_001033352.1.45076 WP_001033352.1.45104 WP_001033352.1.45116 WP_001033352.1.45156 WP_001033352.1.4516 WP_001033352.1.45195 WP_001033352.1.45208 WP_001033352.1.4524 WP_001033352.1.45246 WP_001033352.1.45293 WP_001033352.1.45329 WP_001033352.1.45359 WP_001033352.1.45404 WP_001033352.1.45440 WP_001033352.1.4549 WP_001033352.1.45494 WP_001033352.1.45500 WP_001033352.1.45565 WP_001033352.1.45575 WP_001033352.1.45581 WP_001033352.1.45595 WP_001033352.1.45600 WP_001033352.1.4563 WP_001033352.1.45664 WP_001033352.1.4570 WP_001033352.1.4574 WP_001033352.1.45741 WP_001033352.1.45840 WP_001033352.1.45841 WP_001033352.1.45865 WP_001033352.1.45868 WP_001033352.1.45901 WP_001033352.1.4593 WP_001033352.1.45930 WP_001033352.1.45933 WP_001033352.1.45941 WP_001033352.1.45960 WP_001033352.1.45962 WP_001033352.1.45968 WP_001033352.1.45991 WP_001033352.1.46026 WP_001033352.1.46027 WP_001033352.1.46039 WP_001033352.1.46049 WP_001033352.1.46081 WP_001033352.1.46105 WP_001033352.1.46115 WP_001033352.1.4613 WP_001033352.1.4617 WP_001033352.1.46186 WP_001033352.1.4619 WP_001033352.1.46197 WP_001033352.1.46213 WP_001033352.1.46239 WP_001033352.1.46245 WP_001033352.1.46257 WP_001033352.1.46282 WP_001033352.1.46283 WP_001033352.1.46301 WP_001033352.1.46325 WP_001033352.1.46329 WP_001033352.1.46369 WP_001033352.1.46414 WP_001033352.1.4643 WP_001033352.1.46441 WP_001033352.1.46451 WP_001033352.1.4646 WP_001033352.1.46468 WP_001033352.1.46503 WP_001033352.1.46526 WP_001033352.1.46541 WP_001033352.1.46555 WP_001033352.1.46573 WP_001033352.1.46582 WP_001033352.1.46597 WP_001033352.1.46602 WP_001033352.1.46611 WP_001033352.1.46616 WP_001033352.1.46626 WP_001033352.1.46643 WP_001033352.1.46655 WP_001033352.1.46668 WP_001033352.1.4670 WP_001033352.1.46734 WP_001033352.1.46743 WP_001033352.1.46802 WP_001033352.1.46810 WP_001033352.1.46820 WP_001033352.1.46821 WP_001033352.1.46857 WP_001033352.1.46876 WP_001033352.1.46882 WP_001033352.1.46909 WP_001033352.1.4691 WP_001033352.1.46912 WP_001033352.1.46913 WP_001033352.1.46932 WP_001033352.1.46990 WP_001033352.1.46999 WP_001033352.1.47028 WP_001033352.1.47029 WP_001033352.1.47030 WP_001033352.1.47034 WP_001033352.1.47038 WP_001033352.1.47048 WP_001033352.1.47050 WP_001033352.1.47063 WP_001033352.1.47069 WP_001033352.1.4708 WP_001033352.1.47135 WP_001033352.1.47140 WP_001033352.1.47156 WP_001033352.1.47186 WP_001033352.1.4722 WP_001033352.1.47224 WP_001033352.1.4723 WP_001033352.1.47246 WP_001033352.1.47280 WP_001033352.1.47316 WP_001033352.1.47332 WP_001033352.1.47350 WP_001033352.1.47356 WP_001033352.1.47363 WP_001033352.1.47386 WP_001033352.1.47398 WP_001033352.1.47401 WP_001033352.1.47411 WP_001033352.1.47414 WP_001033352.1.47416 WP_001033352.1.47425 WP_001033352.1.47451 WP_001033352.1.47473 WP_001033352.1.47477 WP_001033352.1.47496 WP_001033352.1.47555 WP_001033352.1.47582 WP_001033352.1.47634 WP_001033352.1.47646 WP_001033352.1.47654 WP_001033352.1.47662 WP_001033352.1.47673 WP_001033352.1.4772 WP_001033352.1.4773 WP_001033352.1.47734 WP_001033352.1.47740 WP_001033352.1.47744 WP_001033352.1.47761 WP_001033352.1.47764 WP_001033352.1.47765 WP_001033352.1.47784 WP_001033352.1.47790 WP_001033352.1.47791 WP_001033352.1.47820 WP_001033352.1.47827 WP_001033352.1.47848 WP_001033352.1.4785 WP_001033352.1.47914 WP_001033352.1.47954 WP_001033352.1.47962 WP_001033352.1.47976 WP_001033352.1.47981 WP_001033352.1.47983 WP_001033352.1.47994 WP_001033352.1.48000 WP_001033352.1.48018 WP_001033352.1.48040 WP_001033352.1.48065 WP_001033352.1.48073 WP_001033352.1.48077 WP_001033352.1.48080 WP_001033352.1.48087 WP_001033352.1.48096 WP_001033352.1.48111 WP_001033352.1.4812 WP_001033352.1.48144 WP_001033352.1.48176 WP_001033352.1.48188 WP_001033352.1.48194 WP_001033352.1.48203 WP_001033352.1.48222 WP_001033352.1.48226 WP_001033352.1.48258 WP_001033352.1.48285 WP_001033352.1.48290 WP_001033352.1.48291 WP_001033352.1.48353 WP_001033352.1.48355 WP_001033352.1.48385 WP_001033352.1.48404 WP_001033352.1.48417 WP_001033352.1.48421 WP_001033352.1.48433 WP_001033352.1.48480 WP_001033352.1.48483 WP_001033352.1.48505 WP_001033352.1.48522 WP_001033352.1.4857 WP_001033352.1.48571 WP_001033352.1.48590 WP_001033352.1.486 WP_001033352.1.48602 WP_001033352.1.48615 WP_001033352.1.48678 WP_001033352.1.48697 WP_001033352.1.4871 WP_001033352.1.48712 WP_001033352.1.48771 WP_001033352.1.48801 WP_001033352.1.48806 WP_001033352.1.48825 WP_001033352.1.48847 WP_001033352.1.48860 WP_001033352.1.48901 WP_001033352.1.48907 WP_001033352.1.48910 WP_001033352.1.48921 WP_001033352.1.48926 WP_001033352.1.48928 WP_001033352.1.48953 WP_001033352.1.48954 WP_001033352.1.48970 WP_001033352.1.48974 WP_001033352.1.49009 WP_001033352.1.49107 WP_001033352.1.49124 WP_001033352.1.49136 WP_001033352.1.49147 WP_001033352.1.49190 WP_001033352.1.49229 WP_001033352.1.49236 WP_001033352.1.49243 WP_001033352.1.49259 WP_001033352.1.4931 WP_001033352.1.49332 WP_001033352.1.49336 WP_001033352.1.49363 WP_001033352.1.49401 WP_001033352.1.49431 WP_001033352.1.49459 WP_001033352.1.49464 WP_001033352.1.49481 WP_001033352.1.49482 WP_001033352.1.49496 WP_001033352.1.49528 WP_001033352.1.49531 WP_001033352.1.49537 WP_001033352.1.49546 WP_001033352.1.49558 WP_001033352.1.49567 WP_001033352.1.49599 WP_001033352.1.49621 WP_001033352.1.49645 WP_001033352.1.49655 WP_001033352.1.49661 WP_001033352.1.49684 WP_001033352.1.497 WP_001033352.1.49712 WP_001033352.1.49722 WP_001033352.1.49733 WP_001033352.1.49740 WP_001033352.1.49768 WP_001033352.1.49771 WP_001033352.1.49774 WP_001033352.1.49777 WP_001033352.1.49823 WP_001033352.1.49856 WP_001033352.1.49861 WP_001033352.1.49879 WP_001033352.1.49883 WP_001033352.1.49900 WP_001033352.1.49902 WP_001033352.1.49950 WP_001033352.1.49954 WP_001033352.1.50006 WP_001033352.1.50008 WP_001033352.1.5003 WP_001033352.1.50036 WP_001033352.1.50078 WP_001033352.1.50098 WP_001033352.1.50110 WP_001033352.1.50113 WP_001033352.1.50119 WP_001033352.1.50136 WP_001033352.1.5017 WP_001033352.1.50182 WP_001033352.1.50196 WP_001033352.1.50207 WP_001033352.1.50230 WP_001033352.1.50258 WP_001033352.1.50262 WP_001033352.1.50273 WP_001033352.1.50278 WP_001033352.1.50304 WP_001033352.1.50329 WP_001033352.1.50345 WP_001033352.1.50353 WP_001033352.1.50358 WP_001033352.1.50361 WP_001033352.1.50366 WP_001033352.1.5037 WP_001033352.1.50380 WP_001033352.1.50381 WP_001033352.1.5040 WP_001033352.1.5041 WP_001033352.1.50412 WP_001033352.1.50418 WP_001033352.1.50452 WP_001033352.1.5046 WP_001033352.1.50539 WP_001033352.1.50548 WP_001033352.1.50549 WP_001033352.1.5056 WP_001033352.1.50579 WP_001033352.1.50586 WP_001033352.1.506 WP_001033352.1.5061 WP_001033352.1.50616 WP_001033352.1.5064 WP_001033352.1.5067 WP_001033352.1.50715 WP_001033352.1.50717 WP_001033352.1.50725 WP_001033352.1.50762 WP_001033352.1.50936 WP_001033352.1.50969 WP_001033352.1.50986 WP_001033352.1.50993 WP_001033352.1.50996 WP_001033352.1.51013 WP_001033352.1.51027 WP_001033352.1.51042 WP_001033352.1.51058 WP_001033352.1.5106 WP_001033352.1.51109 WP_001033352.1.51127 WP_001033352.1.51154 WP_001033352.1.51171 WP_001033352.1.51172 WP_001033352.1.51175 WP_001033352.1.51201 WP_001033352.1.51255 WP_001033352.1.51260 WP_001033352.1.51278 WP_001033352.1.5128 WP_001033352.1.51299 WP_001033352.1.51300 WP_001033352.1.51320 WP_001033352.1.51325 WP_001033352.1.51336 WP_001033352.1.51354 WP_001033352.1.51364 WP_001033352.1.51380 WP_001033352.1.51405 WP_001033352.1.51425 WP_001033352.1.51427 WP_001033352.1.51441 WP_001033352.1.5146 WP_001033352.1.51482 WP_001033352.1.51490 WP_001033352.1.51495 WP_001033352.1.51503 WP_001033352.1.51505 WP_001033352.1.51513 WP_001033352.1.51525 WP_001033352.1.51537 WP_001033352.1.51539 WP_001033352.1.51542 WP_001033352.1.51548 WP_001033352.1.51552 WP_001033352.1.51580 WP_001033352.1.51587 WP_001033352.1.51600 WP_001033352.1.51624 WP_001033352.1.51629 WP_001033352.1.51643 WP_001033352.1.51662 WP_001033352.1.51693 WP_001033352.1.51707 WP_001033352.1.51718 WP_001033352.1.5172 WP_001033352.1.51784 WP_001033352.1.51834 WP_001033352.1.51869 WP_001033352.1.51873 WP_001033352.1.51906 WP_001033352.1.51968 WP_001033352.1.51985 WP_001033352.1.51988 WP_001033352.1.51999 WP_001033352.1.52002 WP_001033352.1.52011 WP_001033352.1.52020 WP_001033352.1.52039 WP_001033352.1.52044 WP_001033352.1.52062 WP_001033352.1.52076 WP_001033352.1.52111 WP_001033352.1.52126 WP_001033352.1.52127 WP_001033352.1.52135 WP_001033352.1.5217 WP_001033352.1.52171 WP_001033352.1.52186 WP_001033352.1.52200 WP_001033352.1.52211 WP_001033352.1.52214 WP_001033352.1.52225 WP_001033352.1.52230 WP_001033352.1.52236 WP_001033352.1.52240 WP_001033352.1.52243 WP_001033352.1.52249 WP_001033352.1.5227 WP_001033352.1.52272 WP_001033352.1.52304 WP_001033352.1.52305 WP_001033352.1.52324 WP_001033352.1.52328 WP_001033352.1.52333 WP_001033352.1.52378 WP_001033352.1.5239 WP_001033352.1.52399 WP_001033352.1.52413 WP_001033352.1.52419 WP_001033352.1.52421 WP_001033352.1.52492 WP_001033352.1.52496 WP_001033352.1.52524 WP_001033352.1.52543 WP_001033352.1.52544 WP_001033352.1.52554 WP_001033352.1.52558 WP_001033352.1.52567 WP_001033352.1.52601 WP_001033352.1.52612 WP_001033352.1.5265 WP_001033352.1.52691 WP_001033352.1.5272 WP_001033352.1.52735 WP_001033352.1.52755 WP_001033352.1.52762 WP_001033352.1.52777 WP_001033352.1.52780 WP_001033352.1.52801 WP_001033352.1.52844 WP_001033352.1.52852 WP_001033352.1.52853 WP_001033352.1.52881 WP_001033352.1.52883 WP_001033352.1.52895 WP_001033352.1.52908 WP_001033352.1.52913 WP_001033352.1.52933 WP_001033352.1.52942 WP_001033352.1.52962 WP_001033352.1.52995 WP_001033352.1.52996 WP_001033352.1.53012 WP_001033352.1.53020 WP_001033352.1.53027 WP_001033352.1.53065 WP_001033352.1.53084 WP_001033352.1.53095 WP_001033352.1.53099 WP_001033352.1.5310 WP_001033352.1.53110 WP_001033352.1.53155 WP_001033352.1.53181 WP_001033352.1.53186 WP_001033352.1.532 WP_001033352.1.53211 WP_001033352.1.5322 WP_001033352.1.53238 WP_001033352.1.53242 WP_001033352.1.53251 WP_001033352.1.53252 WP_001033352.1.53270 WP_001033352.1.53277 WP_001033352.1.53308 WP_001033352.1.53327 WP_001033352.1.53356 WP_001033352.1.53364 WP_001033352.1.53377 WP_001033352.1.53401 WP_001033352.1.53419 WP_001033352.1.5342 WP_001033352.1.53428 WP_001033352.1.53431 WP_001033352.1.53505 WP_001033352.1.5351 WP_001033352.1.53535 WP_001033352.1.53537 WP_001033352.1.53545 WP_001033352.1.53574 WP_001033352.1.53582 WP_001033352.1.53590 WP_001033352.1.53592 WP_001033352.1.53594 WP_001033352.1.5362 WP_001033352.1.53642 WP_001033352.1.53645 WP_001033352.1.53706 WP_001033352.1.53769 WP_001033352.1.53809 WP_001033352.1.53810 WP_001033352.1.53811 WP_001033352.1.53841 WP_001033352.1.53863 WP_001033352.1.53866 WP_001033352.1.53878 WP_001033352.1.53884 WP_001033352.1.5393 WP_001033352.1.53931 WP_001033352.1.5395 WP_001033352.1.53966 WP_001033352.1.53968 WP_001033352.1.53972 WP_001033352.1.53978 WP_001033352.1.53994 WP_001033352.1.54002 WP_001033352.1.54013 WP_001033352.1.54024 WP_001033352.1.54028 WP_001033352.1.54032 WP_001033352.1.54091 WP_001033352.1.54169 WP_001033352.1.54185 WP_001033352.1.54202 WP_001033352.1.54213 WP_001033352.1.54263 WP_001033352.1.54307 WP_001033352.1.54317 WP_001033352.1.54328 WP_001033352.1.54329 WP_001033352.1.5433 WP_001033352.1.54344 WP_001033352.1.54359 WP_001033352.1.5440 WP_001033352.1.5441 WP_001033352.1.54454 WP_001033352.1.54463 WP_001033352.1.54476 WP_001033352.1.54507 WP_001033352.1.54591 WP_001033352.1.5460 WP_001033352.1.54602 WP_001033352.1.54605 WP_001033352.1.54614 WP_001033352.1.54617 WP_001033352.1.54620 WP_001033352.1.54625 WP_001033352.1.54638 WP_001033352.1.54641 WP_001033352.1.5467 WP_001033352.1.54688 WP_001033352.1.54695 WP_001033352.1.54708 WP_001033352.1.54725 WP_001033352.1.54729 WP_001033352.1.54755 WP_001033352.1.54817 WP_001033352.1.54829 WP_001033352.1.5486 WP_001033352.1.54883 WP_001033352.1.54921 WP_001033352.1.54941 WP_001033352.1.54946 WP_001033352.1.54981 WP_001033352.1.55003 WP_001033352.1.55005 WP_001033352.1.55009 WP_001033352.1.55041 WP_001033352.1.55115 WP_001033352.1.55123 WP_001033352.1.55134 WP_001033352.1.55144 WP_001033352.1.55177 WP_001033352.1.55197 WP_001033352.1.5520 WP_001033352.1.55203 WP_001033352.1.55218 WP_001033352.1.55226 WP_001033352.1.55286 WP_001033352.1.55291 WP_001033352.1.55338 WP_001033352.1.55342 WP_001033352.1.55357 WP_001033352.1.55359 WP_001033352.1.55374 WP_001033352.1.55381 WP_001033352.1.55417 WP_001033352.1.55424 WP_001033352.1.55425 WP_001033352.1.55466 WP_001033352.1.55482 WP_001033352.1.55483 WP_001033352.1.55489 WP_001033352.1.55492 WP_001033352.1.55507 WP_001033352.1.55529 WP_001033352.1.55551 WP_001033352.1.55552 WP_001033352.1.55556 WP_001033352.1.55560 WP_001033352.1.55571 WP_001033352.1.55574 WP_001033352.1.55597 WP_001033352.1.55608 WP_001033352.1.5561 WP_001033352.1.55629 WP_001033352.1.5566 WP_001033352.1.55676 WP_001033352.1.5570 WP_001033352.1.55709 WP_001033352.1.55720 WP_001033352.1.55727 WP_001033352.1.55730 WP_001033352.1.55757 WP_001033352.1.55787 WP_001033352.1.55791 WP_001033352.1.55820 WP_001033352.1.55825 WP_001033352.1.55838 WP_001033352.1.55844 WP_001033352.1.55868 WP_001033352.1.55892 WP_001033352.1.55897 WP_001033352.1.55979 WP_001033352.1.55988 WP_001033352.1.56072 WP_001033352.1.56101 WP_001033352.1.5614 WP_001033352.1.56149 WP_001033352.1.56151 WP_001033352.1.56164 WP_001033352.1.56177 WP_001033352.1.56193 WP_001033352.1.56197 WP_001033352.1.56216 WP_001033352.1.56231 WP_001033352.1.56285 WP_001033352.1.56302 WP_001033352.1.56345 WP_001033352.1.56371 WP_001033352.1.56388 WP_001033352.1.5639 WP_001033352.1.56390 WP_001033352.1.56392 WP_001033352.1.56399 WP_001033352.1.56436 WP_001033352.1.56439 WP_001033352.1.56446 WP_001033352.1.5646 WP_001033352.1.56481 WP_001033352.1.56489 WP_001033352.1.5649 WP_001033352.1.56491 WP_001033352.1.56501 WP_001033352.1.56513 WP_001033352.1.56528 WP_001033352.1.56543 WP_001033352.1.56554 WP_001033352.1.56571 WP_001033352.1.56573 WP_001033352.1.56665 WP_001033352.1.56680 WP_001033352.1.56689 WP_001033352.1.5670 WP_001033352.1.56704 WP_001033352.1.56713 WP_001033352.1.56721 WP_001033352.1.56742 WP_001033352.1.56776 WP_001033352.1.56777 WP_001033352.1.56786 WP_001033352.1.56787 WP_001033352.1.56789 WP_001033352.1.56799 WP_001033352.1.56835 WP_001033352.1.56846 WP_001033352.1.56871 WP_001033352.1.56908 WP_001033352.1.56932 WP_001033352.1.56934 WP_001033352.1.56937 WP_001033352.1.56951 WP_001033352.1.56992 WP_001033352.1.57032 WP_001033352.1.57051 WP_001033352.1.57068 WP_001033352.1.57071 WP_001033352.1.57072 WP_001033352.1.57086 WP_001033352.1.57124 WP_001033352.1.57180 WP_001033352.1.57181 WP_001033352.1.57185 WP_001033352.1.57197 WP_001033352.1.57216 WP_001033352.1.57222 WP_001033352.1.57254 WP_001033352.1.57269 WP_001033352.1.57280 WP_001033352.1.57281 WP_001033352.1.57319 WP_001033352.1.57386 WP_001033352.1.57395 WP_001033352.1.57401 WP_001033352.1.57410 WP_001033352.1.57414 WP_001033352.1.57432 WP_001033352.1.57453 WP_001033352.1.57466 WP_001033352.1.5748 WP_001033352.1.57487 WP_001033352.1.57517 WP_001033352.1.57538 WP_001033352.1.5755 WP_001033352.1.57558 WP_001033352.1.57574 WP_001033352.1.57588 WP_001033352.1.57610 WP_001033352.1.57628 WP_001033352.1.57629 WP_001033352.1.57634 WP_001033352.1.57638 WP_001033352.1.5764 WP_001033352.1.57646 WP_001033352.1.57663 WP_001033352.1.57669 WP_001033352.1.57719 WP_001033352.1.57738 WP_001033352.1.57812 WP_001033352.1.57836 WP_001033352.1.57846 WP_001033352.1.5786 WP_001033352.1.57898 WP_001033352.1.57903 WP_001033352.1.57904 WP_001033352.1.57920 WP_001033352.1.57951 WP_001033352.1.57975 WP_001033352.1.58001 WP_001033352.1.58022 WP_001033352.1.58045 WP_001033352.1.58048 WP_001033352.1.58057 WP_001033352.1.58060 WP_001033352.1.58080 WP_001033352.1.5810 WP_001033352.1.58128 WP_001033352.1.58143 WP_001033352.1.58146 WP_001033352.1.58163 WP_001033352.1.58169 WP_001033352.1.58172 WP_001033352.1.58226 WP_001033352.1.58232 WP_001033352.1.58238 WP_001033352.1.58267 WP_001033352.1.58289 WP_001033352.1.58316 WP_001033352.1.58368 WP_001033352.1.58371 WP_001033352.1.58384 WP_001033352.1.584 WP_001033352.1.58401 WP_001033352.1.58408 WP_001033352.1.5842 WP_001033352.1.58420 WP_001033352.1.58423 WP_001033352.1.58429 WP_001033352.1.58440 WP_001033352.1.58445 WP_001033352.1.58475 WP_001033352.1.58484 WP_001033352.1.58496 WP_001033352.1.58507 WP_001033352.1.58514 WP_001033352.1.5852 WP_001033352.1.58547 WP_001033352.1.58582 WP_001033352.1.58622 WP_001033352.1.58680 WP_001033352.1.58705 WP_001033352.1.58707 WP_001033352.1.58723 WP_001033352.1.58837 WP_001033352.1.58867 WP_001033352.1.58870 WP_001033352.1.58901 WP_001033352.1.58940 WP_001033352.1.58942 WP_001033352.1.58951 WP_001033352.1.58958 WP_001033352.1.58976 WP_001033352.1.58977 WP_001033352.1.58983 WP_001033352.1.59024 WP_001033352.1.59026 WP_001033352.1.59035 WP_001033352.1.59038 WP_001033352.1.59047 WP_001033352.1.59083 WP_001033352.1.59119 WP_001033352.1.59174 WP_001033352.1.59190 WP_001033352.1.59199 WP_001033352.1.59218 WP_001033352.1.59293 WP_001033352.1.59302 WP_001033352.1.59306 WP_001033352.1.59374 WP_001033352.1.59395 WP_001033352.1.59396 WP_001033352.1.59407 WP_001033352.1.59409 WP_001033352.1.59413 WP_001033352.1.59423 WP_001033352.1.59470 WP_001033352.1.59491 WP_001033352.1.59513 WP_001033352.1.59533 WP_001033352.1.59553 WP_001033352.1.59590 WP_001033352.1.59615 WP_001033352.1.59621 WP_001033352.1.5965 WP_001033352.1.59679 WP_001033352.1.59689 WP_001033352.1.59699 WP_001033352.1.597 WP_001033352.1.59730 WP_001033352.1.59756 WP_001033352.1.59782 WP_001033352.1.59791 WP_001033352.1.59823 WP_001033352.1.59836 WP_001033352.1.59838 WP_001033352.1.59855 WP_001033352.1.59877 WP_001033352.1.5990 WP_001033352.1.59905 WP_001033352.1.59912 WP_001033352.1.59914 WP_001033352.1.59932 WP_001033352.1.59959 WP_001033352.1.59998 WP_001033352.1.60005 WP_001033352.1.6002 WP_001033352.1.60023 WP_001033352.1.60031 WP_001033352.1.60042 WP_001033352.1.60043 WP_001033352.1.60067 WP_001033352.1.60070 WP_001033352.1.60095 WP_001033352.1.60117 WP_001033352.1.6013 WP_001033352.1.60186 WP_001033352.1.6022 WP_001033352.1.60228 WP_001033352.1.60246 WP_001033352.1.60304 WP_001033352.1.60325 WP_001033352.1.60343 WP_001033352.1.60374 WP_001033352.1.60443 WP_001033352.1.60457 WP_001033352.1.60461 WP_001033352.1.60477 WP_001033352.1.60491 WP_001033352.1.60498 WP_001033352.1.60505 WP_001033352.1.60550 WP_001033352.1.60559 WP_001033352.1.60567 WP_001033352.1.60570 WP_001033352.1.60576 WP_001033352.1.6059 WP_001033352.1.60599 WP_001033352.1.60606 WP_001033352.1.6061 WP_001033352.1.60613 WP_001033352.1.60614 WP_001033352.1.60644 WP_001033352.1.60647 WP_001033352.1.6066 WP_001033352.1.60671 WP_001033352.1.60684 WP_001033352.1.60698 WP_001033352.1.60717 WP_001033352.1.60744 WP_001033352.1.60761 WP_001033352.1.60764 WP_001033352.1.60771 WP_001033352.1.60816 WP_001033352.1.60826 WP_001033352.1.60835 WP_001033352.1.60847 WP_001033352.1.60872 WP_001033352.1.60895 WP_001033352.1.60901 WP_001033352.1.60921 WP_001033352.1.60927 WP_001033352.1.60935 WP_001033352.1.6094 WP_001033352.1.60974 WP_001033352.1.61005 WP_001033352.1.61008 WP_001033352.1.61035 WP_001033352.1.61039 WP_001033352.1.61058 WP_001033352.1.61096 WP_001033352.1.61099 WP_001033352.1.6110 WP_001033352.1.61102 WP_001033352.1.61108 WP_001033352.1.61112 WP_001033352.1.61148 WP_001033352.1.61170 WP_001033352.1.61174 WP_001033352.1.61183 WP_001033352.1.61186 WP_001033352.1.61223 WP_001033352.1.61241 WP_001033352.1.61253 WP_001033352.1.61268 WP_001033352.1.61292 WP_001033352.1.61362 WP_001033352.1.61373 WP_001033352.1.61496 WP_001033352.1.61505 WP_001033352.1.61517 WP_001033352.1.61524 WP_001033352.1.61551 WP_001033352.1.61608 WP_001033352.1.61612 WP_001033352.1.61623 WP_001033352.1.61636 WP_001033352.1.61643 WP_001033352.1.61663 WP_001033352.1.61703 WP_001033352.1.61718 WP_001033352.1.61770 WP_001033352.1.61772 WP_001033352.1.61779 WP_001033352.1.618 WP_001033352.1.61806 WP_001033352.1.61822 WP_001033352.1.61853 WP_001033352.1.61874 WP_001033352.1.61893 WP_001033352.1.61939 WP_001033352.1.61948 WP_001033352.1.61949 WP_001033352.1.61955 WP_001033352.1.61957 WP_001033352.1.61966 WP_001033352.1.62041 WP_001033352.1.62099 WP_001033352.1.6212 WP_001033352.1.62157 WP_001033352.1.62182 WP_001033352.1.62303 WP_001033352.1.62337 WP_001033352.1.62348 WP_001033352.1.62447 WP_001033352.1.6245 WP_001033352.1.62460 WP_001033352.1.62480 WP_001033352.1.62487 WP_001033352.1.62507 WP_001033352.1.62513 WP_001033352.1.62514 WP_001033352.1.62529 WP_001033352.1.6261 WP_001033352.1.62612 WP_001033352.1.62642 WP_001033352.1.62646 WP_001033352.1.62668 WP_001033352.1.62675 WP_001033352.1.62681 WP_001033352.1.62714 WP_001033352.1.62735 WP_001033352.1.62750 WP_001033352.1.62762 WP_001033352.1.62769 WP_001033352.1.62787 WP_001033352.1.62802 WP_001033352.1.62812 WP_001033352.1.62818 WP_001033352.1.62840 WP_001033352.1.62843 WP_001033352.1.62850 WP_001033352.1.62851 WP_001033352.1.62888 WP_001033352.1.62914 WP_001033352.1.6293 WP_001033352.1.62931 WP_001033352.1.62959 WP_001033352.1.62973 WP_001033352.1.62989 WP_001033352.1.6299 WP_001033352.1.62992 WP_001033352.1.63023 WP_001033352.1.63078 WP_001033352.1.63167 WP_001033352.1.63177 WP_001033352.1.63189 WP_001033352.1.6323 WP_001033352.1.63246 WP_001033352.1.63287 WP_001033352.1.6331 WP_001033352.1.6337 WP_001033352.1.63370 WP_001033352.1.63374 WP_001033352.1.63393 WP_001033352.1.63435 WP_001033352.1.63437 WP_001033352.1.63445 WP_001033352.1.63453 WP_001033352.1.63466 WP_001033352.1.63467 WP_001033352.1.63470 WP_001033352.1.63478 WP_001033352.1.6348 WP_001033352.1.63484 WP_001033352.1.63536 WP_001033352.1.63556 WP_001033352.1.63586 WP_001033352.1.63602 WP_001033352.1.63615 WP_001033352.1.6364 WP_001033352.1.63666 WP_001033352.1.63679 WP_001033352.1.63683 WP_001033352.1.63703 WP_001033352.1.63746 WP_001033352.1.63800 WP_001033352.1.63810 WP_001033352.1.63821 WP_001033352.1.63871 WP_001033352.1.63872 WP_001033352.1.63964 WP_001033352.1.63990 WP_001033352.1.64008 WP_001033352.1.64014 WP_001033352.1.64040 WP_001033352.1.64050 WP_001033352.1.64074 WP_001033352.1.64086 WP_001033352.1.64110 WP_001033352.1.64150 WP_001033352.1.6416 WP_001033352.1.64161 WP_001033352.1.64175 WP_001033352.1.64280 WP_001033352.1.64285 WP_001033352.1.64286 WP_001033352.1.6431 WP_001033352.1.64321 WP_001033352.1.64337 WP_001033352.1.64353 WP_001033352.1.64356 WP_001033352.1.64371 WP_001033352.1.64380 WP_001033352.1.6441 WP_001033352.1.64437 WP_001033352.1.64438 WP_001033352.1.64448 WP_001033352.1.64519 WP_001033352.1.64528 WP_001033352.1.64540 WP_001033352.1.64563 WP_001033352.1.64621 WP_001033352.1.64634 WP_001033352.1.64657 WP_001033352.1.6469 WP_001033352.1.64693 WP_001033352.1.64707 WP_001033352.1.64746 WP_001033352.1.64749 WP_001033352.1.64784 WP_001033352.1.64789 WP_001033352.1.64821 WP_001033352.1.64866 WP_001033352.1.64881 WP_001033352.1.64895 WP_001033352.1.64912 WP_001033352.1.64926 WP_001033352.1.64939 WP_001033352.1.64946 WP_001033352.1.65035 WP_001033352.1.65040 WP_001033352.1.65084 WP_001033352.1.651 WP_001033352.1.6511 WP_001033352.1.65110 WP_001033352.1.65118 WP_001033352.1.65135 WP_001033352.1.65151 WP_001033352.1.65155 WP_001033352.1.65192 WP_001033352.1.65194 WP_001033352.1.65206 WP_001033352.1.65256 WP_001033352.1.65271 WP_001033352.1.65296 WP_001033352.1.65305 WP_001033352.1.65306 WP_001033352.1.65353 WP_001033352.1.65364 WP_001033352.1.6537 WP_001033352.1.65372 WP_001033352.1.654 WP_001033352.1.65408 WP_001033352.1.65413 WP_001033352.1.65415 WP_001033352.1.65493 WP_001033352.1.6553 WP_001033352.1.65546 WP_001033352.1.65596 WP_001033352.1.6563 WP_001033352.1.65662 WP_001033352.1.65667 WP_001033352.1.65672 WP_001033352.1.65677 WP_001033352.1.65708 WP_001033352.1.65714 WP_001033352.1.6587 WP_001033352.1.65875 WP_001033352.1.65898 WP_001033352.1.65912 WP_001033352.1.65954 WP_001033352.1.65961 WP_001033352.1.65962 WP_001033352.1.65963 WP_001033352.1.65978 WP_001033352.1.65988 WP_001033352.1.6599 WP_001033352.1.65991 WP_001033352.1.66001 WP_001033352.1.66033 WP_001033352.1.6604 WP_001033352.1.66050 WP_001033352.1.6609 WP_001033352.1.66100 WP_001033352.1.66102 WP_001033352.1.66104 WP_001033352.1.66105 WP_001033352.1.66127 WP_001033352.1.66181 WP_001033352.1.66187 WP_001033352.1.66197 WP_001033352.1.6622 WP_001033352.1.66251 WP_001033352.1.66264 WP_001033352.1.66280 WP_001033352.1.66288 WP_001033352.1.66327 WP_001033352.1.66335 WP_001033352.1.6635 WP_001033352.1.66387 WP_001033352.1.66389 WP_001033352.1.66395 WP_001033352.1.66412 WP_001033352.1.66432 WP_001033352.1.6645 WP_001033352.1.66501 WP_001033352.1.66531 WP_001033352.1.6654 WP_001033352.1.66550 WP_001033352.1.66559 WP_001033352.1.66566 WP_001033352.1.66579 WP_001033352.1.66624 WP_001033352.1.66644 WP_001033352.1.6665 WP_001033352.1.66700 WP_001033352.1.66719 WP_001033352.1.6676 WP_001033352.1.66783 WP_001033352.1.66791 WP_001033352.1.66795 WP_001033352.1.66849 WP_001033352.1.66873 WP_001033352.1.66922 WP_001033352.1.66926 WP_001033352.1.66933 WP_001033352.1.66948 WP_001033352.1.66975 WP_001033352.1.67018 WP_001033352.1.67021 WP_001033352.1.67022 WP_001033352.1.67026 WP_001033352.1.67073 WP_001033352.1.67102 WP_001033352.1.67116 WP_001033352.1.67120 WP_001033352.1.67136 WP_001033352.1.67137 WP_001033352.1.67149 WP_001033352.1.67150 WP_001033352.1.67158 WP_001033352.1.67193 WP_001033352.1.67200 WP_001033352.1.67209 WP_001033352.1.67210 WP_001033352.1.67214 WP_001033352.1.6723 WP_001033352.1.67272 WP_001033352.1.67293 WP_001033352.1.6735 WP_001033352.1.67383 WP_001033352.1.67415 WP_001033352.1.67452 WP_001033352.1.67454 WP_001033352.1.67462 WP_001033352.1.67467 WP_001033352.1.67468 WP_001033352.1.67522 WP_001033352.1.67533 WP_001033352.1.67538 WP_001033352.1.67549 WP_001033352.1.67553 WP_001033352.1.67581 WP_001033352.1.67660 WP_001033352.1.67663 WP_001033352.1.67676 WP_001033352.1.6769 WP_001033352.1.67704 WP_001033352.1.67724 WP_001033352.1.67726 WP_001033352.1.67732 WP_001033352.1.67753 WP_001033352.1.67775 WP_001033352.1.67780 WP_001033352.1.67786 WP_001033352.1.67787 WP_001033352.1.67802 WP_001033352.1.67853 WP_001033352.1.67861 WP_001033352.1.67901 WP_001033352.1.67938 WP_001033352.1.67971 WP_001033352.1.67975 WP_001033352.1.67984 WP_001033352.1.67990 WP_001033352.1.67999 WP_001033352.1.68008 WP_001033352.1.68011 WP_001033352.1.6802 WP_001033352.1.68025 WP_001033352.1.6803 WP_001033352.1.68039 WP_001033352.1.68053 WP_001033352.1.68069 WP_001033352.1.68079 WP_001033352.1.68096 WP_001033352.1.68108 WP_001033352.1.68126 WP_001033352.1.6814 WP_001033352.1.68145 WP_001033352.1.68170 WP_001033352.1.68175 WP_001033352.1.682 WP_001033352.1.68215 WP_001033352.1.68241 WP_001033352.1.68255 WP_001033352.1.68281 WP_001033352.1.68300 WP_001033352.1.68336 WP_001033352.1.68341 WP_001033352.1.68347 WP_001033352.1.68369 WP_001033352.1.68396 WP_001033352.1.68411 WP_001033352.1.68442 WP_001033352.1.68482 WP_001033352.1.68493 WP_001033352.1.68523 WP_001033352.1.68534 WP_001033352.1.68566 WP_001033352.1.68584 WP_001033352.1.68598 WP_001033352.1.6860 WP_001033352.1.68609 WP_001033352.1.68630 WP_001033352.1.68635 WP_001033352.1.68673 WP_001033352.1.68678 WP_001033352.1.68695 WP_001033352.1.68697 WP_001033352.1.68711 WP_001033352.1.68751 WP_001033352.1.68752 WP_001033352.1.6877 WP_001033352.1.68797 WP_001033352.1.6880 WP_001033352.1.6887 WP_001033352.1.68873 WP_001033352.1.68880 WP_001033352.1.68915 WP_001033352.1.68961 WP_001033352.1.68989 WP_001033352.1.69033 WP_001033352.1.69039 WP_001033352.1.69054 WP_001033352.1.69098 WP_001033352.1.69126 WP_001033352.1.6916 WP_001033352.1.6919 WP_001033352.1.69192 WP_001033352.1.69247 WP_001033352.1.69258 WP_001033352.1.69261 WP_001033352.1.6929 WP_001033352.1.69303 WP_001033352.1.69305 WP_001033352.1.69350 WP_001033352.1.69441 WP_001033352.1.6945 WP_001033352.1.69472 WP_001033352.1.69473 WP_001033352.1.69537 WP_001033352.1.69551 WP_001033352.1.69583 WP_001033352.1.69589 WP_001033352.1.69593 WP_001033352.1.69596 WP_001033352.1.69646 WP_001033352.1.69649 WP_001033352.1.69655 WP_001033352.1.69689 WP_001033352.1.69730 WP_001033352.1.69780 WP_001033352.1.69786 WP_001033352.1.69803 WP_001033352.1.69810 WP_001033352.1.69818 WP_001033352.1.69887 WP_001033352.1.69896 WP_001033352.1.6993 WP_001033352.1.69972 WP_001033352.1.69979 WP_001033352.1.70063 WP_001033352.1.70081 WP_001033352.1.70123 WP_001033352.1.70125 WP_001033352.1.70149 WP_001033352.1.70190 WP_001033352.1.70256 WP_001033352.1.70357 WP_001033352.1.70370 WP_001033352.1.70407 WP_001033352.1.70414 WP_001033352.1.70477 WP_001033352.1.70492 WP_001033352.1.70509 WP_001033352.1.70517 WP_001033352.1.7052 WP_001033352.1.70530 WP_001033352.1.70576 WP_001033352.1.70578 WP_001033352.1.70582 WP_001033352.1.70592 WP_001033352.1.70600 WP_001033352.1.70619 WP_001033352.1.70628 WP_001033352.1.70656 WP_001033352.1.70694 WP_001033352.1.70698 WP_001033352.1.70713 WP_001033352.1.70723 WP_001033352.1.70728 WP_001033352.1.70745 WP_001033352.1.70747 WP_001033352.1.70748 WP_001033352.1.70767 WP_001033352.1.70787 WP_001033352.1.70794 WP_001033352.1.70801 WP_001033352.1.70803 WP_001033352.1.70880 WP_001033352.1.7090 WP_001033352.1.70900 WP_001033352.1.70952 WP_001033352.1.70967 WP_001033352.1.71003 WP_001033352.1.71024 WP_001033352.1.71037 WP_001033352.1.71042 WP_001033352.1.71062 WP_001033352.1.71099 WP_001033352.1.71109 WP_001033352.1.71113 WP_001033352.1.71134 WP_001033352.1.71159 WP_001033352.1.71162 WP_001033352.1.71170 WP_001033352.1.71176 WP_001033352.1.71192 WP_001033352.1.71199 WP_001033352.1.71205 WP_001033352.1.71221 WP_001033352.1.71223 WP_001033352.1.71225 WP_001033352.1.71226 WP_001033352.1.71229 WP_001033352.1.71264 WP_001033352.1.71269 WP_001033352.1.71272 WP_001033352.1.71275 WP_001033352.1.71312 WP_001033352.1.71315 WP_001033352.1.71323 WP_001033352.1.71327 WP_001033352.1.71339 WP_001033352.1.71397 WP_001033352.1.71403 WP_001033352.1.71409 WP_001033352.1.71448 WP_001033352.1.7147 WP_001033352.1.71480 WP_001033352.1.71522 WP_001033352.1.71533 WP_001033352.1.71537 WP_001033352.1.71540 WP_001033352.1.71560 WP_001033352.1.71603 WP_001033352.1.71632 WP_001033352.1.71680 WP_001033352.1.71690 WP_001033352.1.71712 WP_001033352.1.71757 WP_001033352.1.71767 WP_001033352.1.71783 WP_001033352.1.71832 WP_001033352.1.71840 WP_001033352.1.71856 WP_001033352.1.71922 WP_001033352.1.71938 WP_001033352.1.71940 WP_001033352.1.71944 WP_001033352.1.71945 WP_001033352.1.71975 WP_001033352.1.71987 WP_001033352.1.71993 WP_001033352.1.72013 WP_001033352.1.72016 WP_001033352.1.72021 WP_001033352.1.72033 WP_001033352.1.7205 WP_001033352.1.72054 WP_001033352.1.72090 WP_001033352.1.7210 WP_001033352.1.72120 WP_001033352.1.72125 WP_001033352.1.72126 WP_001033352.1.72155 WP_001033352.1.72157 WP_001033352.1.72180 WP_001033352.1.72184 WP_001033352.1.72237 WP_001033352.1.72240 WP_001033352.1.7225 WP_001033352.1.72262 WP_001033352.1.72270 WP_001033352.1.72293 WP_001033352.1.72322 WP_001033352.1.72337 WP_001033352.1.72362 WP_001033352.1.72391 WP_001033352.1.72392 WP_001033352.1.72397 WP_001033352.1.72414 WP_001033352.1.72427 WP_001033352.1.72431 WP_001033352.1.72485 WP_001033352.1.72511 WP_001033352.1.72521 WP_001033352.1.72522 WP_001033352.1.72535 WP_001033352.1.72574 WP_001033352.1.72582 WP_001033352.1.72593 WP_001033352.1.72606 WP_001033352.1.72608 WP_001033352.1.72614 WP_001033352.1.72615 WP_001033352.1.72616 WP_001033352.1.72641 WP_001033352.1.72643 WP_001033352.1.72651 WP_001033352.1.72663 WP_001033352.1.72694 WP_001033352.1.72695 WP_001033352.1.72698 WP_001033352.1.72738 WP_001033352.1.72745 WP_001033352.1.72747 WP_001033352.1.72751 WP_001033352.1.72764 WP_001033352.1.7277 WP_001033352.1.72778 WP_001033352.1.72804 WP_001033352.1.72806 WP_001033352.1.72837 WP_001033352.1.72860 WP_001033352.1.72869 WP_001033352.1.7291 WP_001033352.1.72910 WP_001033352.1.72913 WP_001033352.1.72947 WP_001033352.1.72956 WP_001033352.1.72998 WP_001033352.1.73010 WP_001033352.1.73015 WP_001033352.1.73032 WP_001033352.1.7307 WP_001033352.1.73075 WP_001033352.1.73085 WP_001033352.1.73126 WP_001033352.1.73129 WP_001033352.1.73193 WP_001033352.1.73197 WP_001033352.1.73217 WP_001033352.1.73243 WP_001033352.1.73249 WP_001033352.1.73251 WP_001033352.1.73257 WP_001033352.1.73259 WP_001033352.1.73278 WP_001033352.1.73292 WP_001033352.1.73295 WP_001033352.1.73326 WP_001033352.1.73340 WP_001033352.1.73343 WP_001033352.1.73385 WP_001033352.1.73428 WP_001033352.1.73468 WP_001033352.1.73498 WP_001033352.1.73524 WP_001033352.1.73565 WP_001033352.1.73592 WP_001033352.1.73604 WP_001033352.1.73626 WP_001033352.1.73631 WP_001033352.1.73652 WP_001033352.1.73663 WP_001033352.1.73700 WP_001033352.1.73709 WP_001033352.1.73717 WP_001033352.1.73743 WP_001033352.1.7376 WP_001033352.1.73797 WP_001033352.1.73801 WP_001033352.1.73811 WP_001033352.1.73827 WP_001033352.1.73835 WP_001033352.1.73843 WP_001033352.1.73844 WP_001033352.1.73859 WP_001033352.1.73882 WP_001033352.1.73897 WP_001033352.1.73908 WP_001033352.1.7392 WP_001033352.1.73934 WP_001033352.1.73942 WP_001033352.1.73968 WP_001033352.1.73980 WP_001033352.1.73992 WP_001033352.1.73995 WP_001033352.1.73996 WP_001033352.1.74051 WP_001033352.1.74053 WP_001033352.1.7411 WP_001033352.1.74123 WP_001033352.1.7413 WP_001033352.1.74156 WP_001033352.1.74184 WP_001033352.1.74213 WP_001033352.1.74223 WP_001033352.1.7424 WP_001033352.1.74243 WP_001033352.1.7425 WP_001033352.1.74251 WP_001033352.1.7429 WP_001033352.1.74294 WP_001033352.1.74309 WP_001033352.1.74365 WP_001033352.1.74423 WP_001033352.1.74431 WP_001033352.1.74444 WP_001033352.1.74445 WP_001033352.1.7446 WP_001033352.1.74465 WP_001033352.1.74478 WP_001033352.1.74491 WP_001033352.1.74501 WP_001033352.1.74520 WP_001033352.1.74528 WP_001033352.1.74532 WP_001033352.1.74536 WP_001033352.1.7461 WP_001033352.1.74624 WP_001033352.1.74625 WP_001033352.1.74652 WP_001033352.1.74688 WP_001033352.1.74689 WP_001033352.1.74691 WP_001033352.1.74705 WP_001033352.1.7471 WP_001033352.1.74713 WP_001033352.1.74716 WP_001033352.1.74720 WP_001033352.1.74735 WP_001033352.1.7475 WP_001033352.1.74752 WP_001033352.1.7478 WP_001033352.1.7479 WP_001033352.1.74793 WP_001033352.1.74811 WP_001033352.1.74828 WP_001033352.1.74844 WP_001033352.1.74852 WP_001033352.1.74854 WP_001033352.1.74860 WP_001033352.1.74867 WP_001033352.1.74873 WP_001033352.1.74879 WP_001033352.1.74889 WP_001033352.1.74895 WP_001033352.1.74904 WP_001033352.1.74914 WP_001033352.1.74962 WP_001033352.1.74975 WP_001033352.1.74993 WP_001033352.1.74998 WP_001033352.1.75003 WP_001033352.1.75021 WP_001033352.1.75029 WP_001033352.1.75030 WP_001033352.1.75050 WP_001033352.1.75112 WP_001033352.1.75138 WP_001033352.1.75139 WP_001033352.1.75143 WP_001033352.1.75145 WP_001033352.1.75149 WP_001033352.1.75155 WP_001033352.1.75164 WP_001033352.1.75181 WP_001033352.1.75209 WP_001033352.1.75219 WP_001033352.1.75221 WP_001033352.1.75243 WP_001033352.1.75247 WP_001033352.1.75254 WP_001033352.1.75272 WP_001033352.1.7536 WP_001033352.1.75360 WP_001033352.1.75367 WP_001033352.1.75382 WP_001033352.1.7539 WP_001033352.1.75428 WP_001033352.1.75491 WP_001033352.1.75507 WP_001033352.1.75515 WP_001033352.1.75529 WP_001033352.1.75537 WP_001033352.1.75568 WP_001033352.1.75588 WP_001033352.1.75594 WP_001033352.1.75602 WP_001033352.1.75612 WP_001033352.1.75629 WP_001033352.1.75644 WP_001033352.1.75653 WP_001033352.1.75672 WP_001033352.1.75676 WP_001033352.1.75679 WP_001033352.1.75687 WP_001033352.1.75694 WP_001033352.1.75696 WP_001033352.1.75698 WP_001033352.1.75699 WP_001033352.1.75758 WP_001033352.1.75767 WP_001033352.1.75803 WP_001033352.1.7583 WP_001033352.1.75853 WP_001033352.1.75922 WP_001033352.1.75973 WP_001033352.1.75989 WP_001033352.1.75995 WP_001033352.1.75999 WP_001033352.1.76005 WP_001033352.1.76009 WP_001033352.1.7603 WP_001033352.1.76036 WP_001033352.1.76039 WP_001033352.1.7608 WP_001033352.1.76087 WP_001033352.1.76089 WP_001033352.1.76103 WP_001033352.1.76118 WP_001033352.1.76129 WP_001033352.1.76184 WP_001033352.1.76189 WP_001033352.1.76196 WP_001033352.1.76211 WP_001033352.1.76312 WP_001033352.1.76325 WP_001033352.1.76361 WP_001033352.1.7637 WP_001033352.1.76376 WP_001033352.1.76384 WP_001033352.1.76387 WP_001033352.1.76390 WP_001033352.1.76407 WP_001033352.1.76446 WP_001033352.1.76452 WP_001033352.1.76462 WP_001033352.1.76466 WP_001033352.1.76477 WP_001033352.1.76542 WP_001033352.1.76544 WP_001033352.1.76547 WP_001033352.1.76595 WP_001033352.1.7661 WP_001033352.1.76612 WP_001033352.1.76619 WP_001033352.1.76656 WP_001033352.1.76697 WP_001033352.1.76701 WP_001033352.1.76705 WP_001033352.1.76707 WP_001033352.1.76712 WP_001033352.1.76815 WP_001033352.1.76827 WP_001033352.1.76840 WP_001033352.1.76884 WP_001033352.1.76909 WP_001033352.1.76918 WP_001033352.1.76933 WP_001033352.1.76948 WP_001033352.1.76965 WP_001033352.1.76966 WP_001033352.1.7699 WP_001033352.1.77015 WP_001033352.1.77022 WP_001033352.1.77070 WP_001033352.1.77099 WP_001033352.1.77109 WP_001033352.1.77120 WP_001033352.1.77128 WP_001033352.1.77147 WP_001033352.1.77162 WP_001033352.1.77163 WP_001033352.1.77173 WP_001033352.1.77175 WP_001033352.1.77239 WP_001033352.1.77255 WP_001033352.1.77258 WP_001033352.1.77275 WP_001033352.1.7728 WP_001033352.1.77284 WP_001033352.1.77288 WP_001033352.1.77291 WP_001033352.1.7731 WP_001033352.1.77326 WP_001033352.1.77341 WP_001033352.1.77358 WP_001033352.1.77391 WP_001033352.1.77392 WP_001033352.1.77448 WP_001033352.1.77452 WP_001033352.1.77462 WP_001033352.1.77470 WP_001033352.1.77471 WP_001033352.1.77477 WP_001033352.1.77495 WP_001033352.1.775 WP_001033352.1.77503 WP_001033352.1.77542 WP_001033352.1.77551 WP_001033352.1.77595 WP_001033352.1.77600 WP_001033352.1.77608 WP_001033352.1.77626 WP_001033352.1.77636 WP_001033352.1.77644 WP_001033352.1.77707 WP_001033352.1.77725 WP_001033352.1.77741 WP_001033352.1.77760 WP_001033352.1.77767 WP_001033352.1.77768 WP_001033352.1.7781 WP_001033352.1.77813 WP_001033352.1.77826 WP_001033352.1.77876 WP_001033352.1.77949 WP_001033352.1.7795 WP_001033352.1.77961 WP_001033352.1.77979 WP_001033352.1.7799 WP_001033352.1.77999 WP_001033352.1.78000 WP_001033352.1.78007 WP_001033352.1.78059 WP_001033352.1.7806 WP_001033352.1.78063 WP_001033352.1.7808 WP_001033352.1.78089 WP_001033352.1.78097 WP_001033352.1.78099 WP_001033352.1.78101 WP_001033352.1.78102 WP_001033352.1.78196 WP_001033352.1.78235 WP_001033352.1.78297 WP_001033352.1.78321 WP_001033352.1.78340 WP_001033352.1.78390 WP_001033352.1.784 WP_001033352.1.78413 WP_001033352.1.78445 WP_001033352.1.78462 WP_001033352.1.7847 WP_001033352.1.78481 WP_001033352.1.7851 WP_001033352.1.78527 WP_001033352.1.78553 WP_001033352.1.78581 WP_001033352.1.78583 WP_001033352.1.78586 WP_001033352.1.78593 WP_001033352.1.78610 WP_001033352.1.78611 WP_001033352.1.78612 WP_001033352.1.78615 WP_001033352.1.78645 WP_001033352.1.78683 WP_001033352.1.78687 WP_001033352.1.78696 WP_001033352.1.78698 WP_001033352.1.78718 WP_001033352.1.78746 WP_001033352.1.78750 WP_001033352.1.78757 WP_001033352.1.78775 WP_001033352.1.78791 WP_001033352.1.7883 WP_001033352.1.78843 WP_001033352.1.78854 WP_001033352.1.78888 WP_001033352.1.78891 WP_001033352.1.78919 WP_001033352.1.78953 WP_001033352.1.78966 WP_001033352.1.7898 WP_001033352.1.79002 WP_001033352.1.79004 WP_001033352.1.7901 WP_001033352.1.79065 WP_001033352.1.79067 WP_001033352.1.79086 WP_001033352.1.79088 WP_001033352.1.79090 WP_001033352.1.79092 WP_001033352.1.79172 WP_001033352.1.79226 WP_001033352.1.79246 WP_001033352.1.79306 WP_001033352.1.79308 WP_001033352.1.79312 WP_001033352.1.79343 WP_001033352.1.79356 WP_001033352.1.7937 WP_001033352.1.7940 WP_001033352.1.79416 WP_001033352.1.79478 WP_001033352.1.79519 WP_001033352.1.79526 WP_001033352.1.79528 WP_001033352.1.79540 WP_001033352.1.79558 WP_001033352.1.79563 WP_001033352.1.79576 WP_001033352.1.79591 WP_001033352.1.79606 WP_001033352.1.79685 WP_001033352.1.79713 WP_001033352.1.79715 WP_001033352.1.79764 WP_001033352.1.79800 WP_001033352.1.79816 WP_001033352.1.79824 WP_001033352.1.79840 WP_001033352.1.7985 WP_001033352.1.79869 WP_001033352.1.7987 WP_001033352.1.79871 WP_001033352.1.79877 WP_001033352.1.79905 WP_001033352.1.7993 WP_001033352.1.79930 WP_001033352.1.79931 WP_001033352.1.79932 WP_001033352.1.79936 WP_001033352.1.79944 WP_001033352.1.79965 WP_001033352.1.79984 WP_001033352.1.80011 WP_001033352.1.80043 WP_001033352.1.80050 WP_001033352.1.80060 WP_001033352.1.80061 WP_001033352.1.8007 WP_001033352.1.80071 WP_001033352.1.80106 WP_001033352.1.80112 WP_001033352.1.80136 WP_001033352.1.80141 WP_001033352.1.80176 WP_001033352.1.80179 WP_001033352.1.80192 WP_001033352.1.80255 WP_001033352.1.80292 WP_001033352.1.80309 WP_001033352.1.80310 WP_001033352.1.80320 WP_001033352.1.80330 WP_001033352.1.80426 WP_001033352.1.80428 WP_001033352.1.80440 WP_001033352.1.80444 WP_001033352.1.80456 WP_001033352.1.80484 WP_001033352.1.80517 WP_001033352.1.80519 WP_001033352.1.80524 WP_001033352.1.80545 WP_001033352.1.8057 WP_001033352.1.80578 WP_001033352.1.80594 WP_001033352.1.80606 WP_001033352.1.80612 WP_001033352.1.80626 WP_001033352.1.80662 WP_001033352.1.80666 WP_001033352.1.80676 WP_001033352.1.80709 WP_001033352.1.80731 WP_001033352.1.80736 WP_001033352.1.8074 WP_001033352.1.80753 WP_001033352.1.80754 WP_001033352.1.80756 WP_001033352.1.8076 WP_001033352.1.80789 WP_001033352.1.808 WP_001033352.1.80804 WP_001033352.1.80805 WP_001033352.1.80843 WP_001033352.1.80882 WP_001033352.1.80884 WP_001033352.1.80894 WP_001033352.1.8090 WP_001033352.1.8091 WP_001033352.1.80945 WP_001033352.1.80946 WP_001033352.1.80954 WP_001033352.1.80983 WP_001033352.1.810 WP_001033352.1.81026 WP_001033352.1.81034 WP_001033352.1.81036 WP_001033352.1.81054 WP_001033352.1.81070 WP_001033352.1.81071 WP_001033352.1.811 WP_001033352.1.81127 WP_001033352.1.81160 WP_001033352.1.81165 WP_001033352.1.81180 WP_001033352.1.81182 WP_001033352.1.8121 WP_001033352.1.81273 WP_001033352.1.81281 WP_001033352.1.81286 WP_001033352.1.8129 WP_001033352.1.81298 WP_001033352.1.81313 WP_001033352.1.81316 WP_001033352.1.81376 WP_001033352.1.81391 WP_001033352.1.81420 WP_001033352.1.81438 WP_001033352.1.81442 WP_001033352.1.81469 WP_001033352.1.81475 WP_001033352.1.81484 WP_001033352.1.81514 WP_001033352.1.81517 WP_001033352.1.8156 WP_001033352.1.81576 WP_001033352.1.81577 WP_001033352.1.81580 WP_001033352.1.81582 WP_001033352.1.81589 WP_001033352.1.81596 WP_001033352.1.81602 WP_001033352.1.81625 WP_001033352.1.81688 WP_001033352.1.81692 WP_001033352.1.81715 WP_001033352.1.8172 WP_001033352.1.81723 WP_001033352.1.81754 WP_001033352.1.81806 WP_001033352.1.81819 WP_001033352.1.81821 WP_001033352.1.81832 WP_001033352.1.81881 WP_001033352.1.81934 WP_001033352.1.81939 WP_001033352.1.81952 WP_001033352.1.81956 WP_001033352.1.81972 WP_001033352.1.81975 WP_001033352.1.82 WP_001033352.1.82010 WP_001033352.1.82032 WP_001033352.1.82057 WP_001033352.1.82059 WP_001033352.1.82061 WP_001033352.1.82062 WP_001033352.1.82074 WP_001033352.1.82095 WP_001033352.1.82116 WP_001033352.1.82137 WP_001033352.1.82217 WP_001033352.1.82239 WP_001033352.1.82240 WP_001033352.1.82242 WP_001033352.1.82246 WP_001033352.1.82275 WP_001033352.1.82280 WP_001033352.1.82296 WP_001033352.1.82316 WP_001033352.1.82320 WP_001033352.1.82326 WP_001033352.1.82330 WP_001033352.1.8235 WP_001033352.1.82378 WP_001033352.1.82438 WP_001033352.1.82439 WP_001033352.1.82485 WP_001033352.1.82536 WP_001033352.1.82572 WP_001033352.1.82594 WP_001033352.1.82614 WP_001033352.1.82626 WP_001033352.1.82629 WP_001033352.1.82647 WP_001033352.1.8268 WP_001033352.1.82682 WP_001033352.1.82691 WP_001033352.1.82700 WP_001033352.1.82705 WP_001033352.1.82711 WP_001033352.1.82715 WP_001033352.1.82718 WP_001033352.1.82754 WP_001033352.1.8277 WP_001033352.1.82780 WP_001033352.1.82797 WP_001033352.1.82799 WP_001033352.1.82831 WP_001033352.1.82853 WP_001033352.1.83020 WP_001033352.1.83033 WP_001033352.1.83035 WP_001033352.1.83051 WP_001033352.1.8306 WP_001033352.1.8308 WP_001033352.1.83093 WP_001033352.1.83097 WP_001033352.1.831 WP_001033352.1.83140 WP_001033352.1.83144 WP_001033352.1.83160 WP_001033352.1.83177 WP_001033352.1.83205 WP_001033352.1.83224 WP_001033352.1.83330 WP_001033352.1.83347 WP_001033352.1.8345 WP_001033352.1.83466 WP_001033352.1.83537 WP_001033352.1.83544 WP_001033352.1.83684 WP_001033352.1.83706 WP_001033352.1.83712 WP_001033352.1.83735 WP_001033352.1.83781 WP_001033352.1.83807 WP_001033352.1.83820 WP_001033352.1.83941 WP_001033352.1.83947 WP_001033352.1.84074 WP_001033352.1.8411 WP_001033352.1.84140 WP_001033352.1.84172 WP_001033352.1.84185 WP_001033352.1.84219 WP_001033352.1.84264 WP_001033352.1.84312 WP_001033352.1.84313 WP_001033352.1.84331 WP_001033352.1.84339 WP_001033352.1.84348 WP_001033352.1.84405 WP_001033352.1.84410 WP_001033352.1.8444 WP_001033352.1.84462 WP_001033352.1.84467 WP_001033352.1.84473 WP_001033352.1.84482 WP_001033352.1.84484 WP_001033352.1.84511 WP_001033352.1.84518 WP_001033352.1.84534 WP_001033352.1.84584 WP_001033352.1.84635 WP_001033352.1.84656 WP_001033352.1.84657 WP_001033352.1.84668 WP_001033352.1.84675 WP_001033352.1.84697 WP_001033352.1.84738 WP_001033352.1.84740 WP_001033352.1.84768 WP_001033352.1.8477 WP_001033352.1.84841 WP_001033352.1.84850 WP_001033352.1.84875 WP_001033352.1.84877 WP_001033352.1.84878 WP_001033352.1.84881 WP_001033352.1.84893 WP_001033352.1.84894 WP_001033352.1.84916 WP_001033352.1.84929 WP_001033352.1.84941 WP_001033352.1.84948 WP_001033352.1.84972 WP_001033352.1.84977 WP_001033352.1.84989 WP_001033352.1.84990 WP_001033352.1.84994 WP_001033352.1.85002 WP_001033352.1.85011 WP_001033352.1.85052 WP_001033352.1.85085 WP_001033352.1.85090 WP_001033352.1.85098 WP_001033352.1.85112 WP_001033352.1.85129 WP_001033352.1.85141 WP_001033352.1.85155 WP_001033352.1.85156 WP_001033352.1.85175 WP_001033352.1.85216 WP_001033352.1.85247 WP_001033352.1.85255 WP_001033352.1.85260 WP_001033352.1.85305 WP_001033352.1.85310 WP_001033352.1.85323 WP_001033352.1.85335 WP_001033352.1.85342 WP_001033352.1.85369 WP_001033352.1.85385 WP_001033352.1.85435 WP_001033352.1.85525 WP_001033352.1.85546 WP_001033352.1.85558 WP_001033352.1.85563 WP_001033352.1.8560 WP_001033352.1.85601 WP_001033352.1.85621 WP_001033352.1.85657 WP_001033352.1.85685 WP_001033352.1.85722 WP_001033352.1.85762 WP_001033352.1.85767 WP_001033352.1.85772 WP_001033352.1.85773 WP_001033352.1.8579 WP_001033352.1.85793 WP_001033352.1.85800 WP_001033352.1.85806 WP_001033352.1.85857 WP_001033352.1.85895 WP_001033352.1.8592 WP_001033352.1.85939 WP_001033352.1.85944 WP_001033352.1.86 WP_001033352.1.86001 WP_001033352.1.86035 WP_001033352.1.86063 WP_001033352.1.8607 WP_001033352.1.86105 WP_001033352.1.86115 WP_001033352.1.86145 WP_001033352.1.86149 WP_001033352.1.86161 WP_001033352.1.86171 WP_001033352.1.86181 WP_001033352.1.86189 WP_001033352.1.8621 WP_001033352.1.86210 WP_001033352.1.86225 WP_001033352.1.86228 WP_001033352.1.86255 WP_001033352.1.86263 WP_001033352.1.86266 WP_001033352.1.86276 WP_001033352.1.86280 WP_001033352.1.86283 WP_001033352.1.86307 WP_001033352.1.86340 WP_001033352.1.8635 WP_001033352.1.86355 WP_001033352.1.86364 WP_001033352.1.86371 WP_001033352.1.86376 WP_001033352.1.86393 WP_001033352.1.86412 WP_001033352.1.86451 WP_001033352.1.86452 WP_001033352.1.86454 WP_001033352.1.86461 WP_001033352.1.86475 WP_001033352.1.86492 WP_001033352.1.86518 WP_001033352.1.86574 WP_001033352.1.86583 WP_001033352.1.86598 WP_001033352.1.86609 WP_001033352.1.86617 WP_001033352.1.86640 WP_001033352.1.86667 WP_001033352.1.86674 WP_001033352.1.86691 WP_001033352.1.86760 WP_001033352.1.86833 WP_001033352.1.86846 WP_001033352.1.86848 WP_001033352.1.8687 WP_001033352.1.86935 WP_001033352.1.86956 WP_001033352.1.86959 WP_001033352.1.86975 WP_001033352.1.86994 WP_001033352.1.86997 WP_001033352.1.87059 WP_001033352.1.87075 WP_001033352.1.87076 WP_001033352.1.87109 WP_001033352.1.8711 WP_001033352.1.87177 WP_001033352.1.87189 WP_001033352.1.87249 WP_001033352.1.87254 WP_001033352.1.87310 WP_001033352.1.87339 WP_001033352.1.87382 WP_001033352.1.87389 WP_001033352.1.87410 WP_001033352.1.87465 WP_001033352.1.87557 WP_001033352.1.87563 WP_001033352.1.87568 WP_001033352.1.87574 WP_001033352.1.87607 WP_001033352.1.87608 WP_001033352.1.87610 WP_001033352.1.87616 WP_001033352.1.87639 WP_001033352.1.87655 WP_001033352.1.87694 WP_001033352.1.8771 WP_001033352.1.87721 WP_001033352.1.87726 WP_001033352.1.87788 WP_001033352.1.87789 WP_001033352.1.87834 WP_001033352.1.87857 WP_001033352.1.87919 WP_001033352.1.87980 WP_001033352.1.87984 WP_001033352.1.87989 WP_001033352.1.880 WP_001033352.1.88017 WP_001033352.1.88020 WP_001033352.1.88066 WP_001033352.1.88088 WP_001033352.1.88110 WP_001033352.1.88149 WP_001033352.1.88155 WP_001033352.1.88189 WP_001033352.1.88197 WP_001033352.1.88252 WP_001033352.1.88285 WP_001033352.1.88301 WP_001033352.1.88304 WP_001033352.1.88352 WP_001033352.1.88376 WP_001033352.1.88379 WP_001033352.1.88384 WP_001033352.1.88413 WP_001033352.1.88427 WP_001033352.1.8843 WP_001033352.1.88434 WP_001033352.1.88438 WP_001033352.1.88462 WP_001033352.1.88524 WP_001033352.1.88528 WP_001033352.1.88535 WP_001033352.1.88539 WP_001033352.1.8854 WP_001033352.1.88577 WP_001033352.1.88603 WP_001033352.1.88607 WP_001033352.1.88631 WP_001033352.1.88646 WP_001033352.1.88667 WP_001033352.1.88678 WP_001033352.1.88685 WP_001033352.1.88709 WP_001033352.1.88720 WP_001033352.1.88729 WP_001033352.1.88757 WP_001033352.1.88759 WP_001033352.1.8879 WP_001033352.1.88834 WP_001033352.1.88864 WP_001033352.1.88891 WP_001033352.1.88950 WP_001033352.1.88961 WP_001033352.1.88997 WP_001033352.1.89018 WP_001033352.1.89050 WP_001033352.1.89067 WP_001033352.1.89090 WP_001033352.1.89097 WP_001033352.1.89099 WP_001033352.1.89111 WP_001033352.1.89165 WP_001033352.1.89183 WP_001033352.1.89200 WP_001033352.1.8928 WP_001033352.1.89305 WP_001033352.1.89322 WP_001033352.1.8938 WP_001033352.1.89385 WP_001033352.1.894 WP_001033352.1.89400 WP_001033352.1.89403 WP_001033352.1.89405 WP_001033352.1.89416 WP_001033352.1.89458 WP_001033352.1.89468 WP_001033352.1.89474 WP_001033352.1.89479 WP_001033352.1.89492 WP_001033352.1.89510 WP_001033352.1.89569 WP_001033352.1.89605 WP_001033352.1.89656 WP_001033352.1.89674 WP_001033352.1.89679 WP_001033352.1.89700 WP_001033352.1.89710 WP_001033352.1.89768 WP_001033352.1.89781 WP_001033352.1.89788 WP_001033352.1.89818 WP_001033352.1.89839 WP_001033352.1.89841 WP_001033352.1.8985 WP_001033352.1.89852 WP_001033352.1.89859 WP_001033352.1.89895 WP_001033352.1.89899 WP_001033352.1.89915 WP_001033352.1.89920 WP_001033352.1.89923 WP_001033352.1.89925 WP_001033352.1.89959 WP_001033352.1.89977 WP_001033352.1.90017 WP_001033352.1.90063 WP_001033352.1.90078 WP_001033352.1.9010 WP_001033352.1.90115 WP_001033352.1.90128 WP_001033352.1.90139 WP_001033352.1.90146 WP_001033352.1.90156 WP_001033352.1.90168 WP_001033352.1.90182 WP_001033352.1.90205 WP_001033352.1.90219 WP_001033352.1.90249 WP_001033352.1.90256 WP_001033352.1.90257 WP_001033352.1.90270 WP_001033352.1.90342 WP_001033352.1.90349 WP_001033352.1.90358 WP_001033352.1.9036 WP_001033352.1.90389 WP_001033352.1.90405 WP_001033352.1.90436 WP_001033352.1.90441 WP_001033352.1.90449 WP_001033352.1.90511 WP_001033352.1.90520 WP_001033352.1.90536 WP_001033352.1.90547 WP_001033352.1.90591 WP_001033352.1.90626 WP_001033352.1.90703 WP_001033352.1.90706 WP_001033352.1.90758 WP_001033352.1.90799 WP_001033352.1.9081 WP_001033352.1.90828 WP_001033352.1.90834 WP_001033352.1.90837 WP_001033352.1.90839 WP_001033352.1.9084 WP_001033352.1.90848 WP_001033352.1.90856 WP_001033352.1.90864 WP_001033352.1.90865 WP_001033352.1.90873 WP_001033352.1.90890 WP_001033352.1.90924 WP_001033352.1.90951 WP_001033352.1.90967 WP_001033352.1.90979 WP_001033352.1.9098 WP_001033352.1.90997 WP_001033352.1.91 WP_001033352.1.91018 WP_001033352.1.91072 WP_001033352.1.91088 WP_001033352.1.91117 WP_001033352.1.91121 WP_001033352.1.91138 WP_001033352.1.91170 WP_001033352.1.9118 WP_001033352.1.91266 WP_001033352.1.91277 WP_001033352.1.91288 WP_001033352.1.91290 WP_001033352.1.91340 WP_001033352.1.91341 WP_001033352.1.91356 WP_001033352.1.91384 WP_001033352.1.91397 WP_001033352.1.91414 WP_001033352.1.91445 WP_001033352.1.91462 WP_001033352.1.91485 WP_001033352.1.915 WP_001033352.1.91511 WP_001033352.1.91516 WP_001033352.1.91526 WP_001033352.1.91548 WP_001033352.1.91551 WP_001033352.1.9157 WP_001033352.1.91594 WP_001033352.1.91596 WP_001033352.1.9160 WP_001033352.1.91630 WP_001033352.1.91643 WP_001033352.1.91644 WP_001033352.1.91651 WP_001033352.1.91672 WP_001033352.1.9168 WP_001033352.1.9169 WP_001033352.1.91701 WP_001033352.1.9171 WP_001033352.1.91739 WP_001033352.1.91777 WP_001033352.1.91779 WP_001033352.1.91782 WP_001033352.1.91787 WP_001033352.1.91793 WP_001033352.1.91801 WP_001033352.1.91850 WP_001033352.1.91863 WP_001033352.1.91871 WP_001033352.1.91951 WP_001033352.1.91959 WP_001033352.1.91971 WP_001033352.1.91994 WP_001033352.1.92019 WP_001033352.1.92029 WP_001033352.1.92031 WP_001033352.1.92048 WP_001033352.1.92058 WP_001033352.1.921 WP_001033352.1.92102 WP_001033352.1.9215 WP_001033352.1.92161 WP_001033352.1.92163 WP_001033352.1.92180 WP_001033352.1.92195 WP_001033352.1.92215 WP_001033352.1.92224 WP_001033352.1.92311 WP_001033352.1.92361 WP_001033352.1.924 WP_001033352.1.92434 WP_001033352.1.92462 WP_001033352.1.92495 WP_001033352.1.92496 WP_001033352.1.92506 WP_001033352.1.92532 WP_001033352.1.92535 WP_001033352.1.9255 WP_001033352.1.92568 WP_001033352.1.92571 WP_001033352.1.92614 WP_001033352.1.92615 WP_001033352.1.9264 WP_001033352.1.9266 WP_001033352.1.92668 WP_001033352.1.92693 WP_001033352.1.92708 WP_001033352.1.92719 WP_001033352.1.92742 WP_001033352.1.92780 WP_001033352.1.92781 WP_001033352.1.92792 WP_001033352.1.92793 WP_001033352.1.92796 WP_001033352.1.92819 WP_001033352.1.92845 WP_001033352.1.92865 WP_001033352.1.92932 WP_001033352.1.92943 WP_001033352.1.92953 WP_001033352.1.92989 WP_001033352.1.92991 WP_001033352.1.93005 WP_001033352.1.93019 WP_001033352.1.93023 WP_001033352.1.93027 WP_001033352.1.93048 WP_001033352.1.93054 WP_001033352.1.93069 WP_001033352.1.93085 WP_001033352.1.93100 WP_001033352.1.93175 WP_001033352.1.93252 WP_001033352.1.93267 WP_001033352.1.93276 WP_001033352.1.93309 WP_001033352.1.93312 WP_001033352.1.93338 WP_001033352.1.93379 WP_001033352.1.93427 WP_001033352.1.93428 WP_001033352.1.93468 WP_001033352.1.93509 WP_001033352.1.93531 WP_001033352.1.93569 WP_001033352.1.93601 WP_001033352.1.93626 WP_001033352.1.93630 WP_001033352.1.93634 WP_001033352.1.93637 WP_001033352.1.93652 WP_001033352.1.93665 WP_001033352.1.93670 WP_001033352.1.93673 WP_001033352.1.93695 WP_001033352.1.93733 WP_001033352.1.93742 WP_001033352.1.93745 WP_001033352.1.93755 WP_001033352.1.938 WP_001033352.1.93800 WP_001033352.1.93821 WP_001033352.1.93873 WP_001033352.1.939 WP_001033352.1.93900 WP_001033352.1.93911 WP_001033352.1.93921 WP_001033352.1.93971 WP_001033352.1.94008 WP_001033352.1.94011 WP_001033352.1.94025 WP_001033352.1.94057 WP_001033352.1.94156 WP_001033352.1.94176 WP_001033352.1.94187 WP_001033352.1.94190 WP_001033352.1.94213 WP_001033352.1.94232 WP_001033352.1.9426 WP_001033352.1.94271 WP_001033352.1.94298 WP_001033352.1.94302 WP_001033352.1.94317 WP_001033352.1.94343 WP_001033352.1.94353 WP_001033352.1.94388 WP_001033352.1.94404 WP_001033352.1.94429 WP_001033352.1.94445 WP_001033352.1.94468 WP_001033352.1.94475 WP_001033352.1.94497 WP_001033352.1.94507 WP_001033352.1.94516 WP_001033352.1.94523 WP_001033352.1.94542 WP_001033352.1.94544 WP_001033352.1.94548 WP_001033352.1.9457 WP_001033352.1.94578 WP_001033352.1.94580 WP_001033352.1.94589 WP_001033352.1.94626 WP_001033352.1.94646 WP_001033352.1.94676 WP_001033352.1.94690 WP_001033352.1.94692 WP_001033352.1.94695 WP_001033352.1.94738 WP_001033352.1.94753 WP_001033352.1.94764 WP_001033352.1.94787 WP_001033352.1.94790 WP_001033352.1.948 WP_001033352.1.94801 WP_001033352.1.94806 WP_001033352.1.94808 WP_001033352.1.94822 WP_001033352.1.94836 WP_001033352.1.94877 WP_001033352.1.94889 WP_001033352.1.9489 WP_001033352.1.94898 WP_001033352.1.949 WP_001033352.1.94903 WP_001033352.1.9491 WP_001033352.1.94935 WP_001033352.1.94938 WP_001033352.1.94949 WP_001033352.1.94963 WP_001033352.1.94991 WP_001033352.1.94993 WP_001033352.1.95005 WP_001033352.1.95011 WP_001033352.1.95022 WP_001033352.1.95028 WP_001033352.1.95035 WP_001033352.1.95036 WP_001033352.1.95037 WP_001033352.1.95129 WP_001033352.1.9513 WP_001033352.1.95161 WP_001033352.1.95198 WP_001033352.1.95233 WP_001033352.1.95243 WP_001033352.1.95244 WP_001033352.1.95332 WP_001033352.1.95368 WP_001033352.1.95395 WP_001033352.1.95400 WP_001033352.1.95403 WP_001033352.1.95424 WP_001033352.1.95431 WP_001033352.1.95438 WP_001033352.1.95490 WP_001033352.1.95518 WP_001033352.1.95521 WP_001033352.1.95563 WP_001033352.1.9559 WP_001033352.1.95595 WP_001033352.1.95596 WP_001033352.1.95611 WP_001033352.1.95634 WP_001033352.1.95655 WP_001033352.1.95756 WP_001033352.1.95759 WP_001033352.1.95800 WP_001033352.1.95801 WP_001033352.1.95821 WP_001033352.1.95827 WP_001033352.1.95834 WP_001033352.1.95835 WP_001033352.1.95849 WP_001033352.1.95865 WP_001033352.1.95869 WP_001033352.1.95916 WP_001033352.1.95919 WP_001033352.1.95931 WP_001033352.1.95932 WP_001033352.1.96015 WP_001033352.1.96032 WP_001033352.1.96086 WP_001033352.1.96114 WP_001033352.1.96177 WP_001033352.1.96215 WP_001033352.1.96229 WP_001033352.1.96247 WP_001033352.1.96278 WP_001033352.1.96281 WP_001033352.1.96290 WP_001033352.1.96293 WP_001033352.1.96299 WP_001033352.1.9631 WP_001033352.1.96339 WP_001033352.1.96341 WP_001033352.1.96394 WP_001033352.1.96417 WP_001033352.1.96420 WP_001033352.1.96425 WP_001033352.1.96450 WP_001033352.1.96457 WP_001033352.1.96479 WP_001033352.1.96480 WP_001033352.1.96484 WP_001033352.1.96494 WP_001033352.1.965 WP_001033352.1.96541 WP_001033352.1.96562 WP_001033352.1.9657 WP_001033352.1.96585 WP_001033352.1.9661 WP_001033352.1.96659 WP_001033352.1.9668 WP_001033352.1.96683 WP_001033352.1.96701 WP_001033352.1.96725 WP_001033352.1.96743 WP_001033352.1.96753 WP_001033352.1.96779 WP_001033352.1.96796 WP_001033352.1.96817 WP_001033352.1.96850 WP_001033352.1.9690 WP_001033352.1.9691 WP_001033352.1.96924 WP_001033352.1.96936 WP_001033352.1.96944 WP_001033352.1.96984 WP_001033352.1.96989 WP_001033352.1.97011 WP_001033352.1.97027 WP_001033352.1.97059 WP_001033352.1.9708 WP_001033352.1.97123 WP_001033352.1.97195 WP_001033352.1.97231 WP_001033352.1.97238 WP_001033352.1.97248 WP_001033352.1.97344 WP_001033352.1.97360 WP_001033352.1.97361 WP_001033352.1.9740 WP_001033352.1.97402 WP_001033352.1.97418 WP_001033352.1.97421 WP_001033352.1.97434 WP_001033352.1.97439 WP_001033352.1.97459 WP_001033352.1.9747 WP_001033352.1.97513 WP_001033352.1.97527 WP_001033352.1.97538 WP_001033352.1.97619 WP_001033352.1.97667 WP_001033352.1.97675 WP_001033352.1.97677 WP_001033352.1.97685 WP_001033352.1.9770 WP_001033352.1.97711 WP_001033352.1.97775 WP_001033352.1.97789 WP_001033352.1.97798 WP_001033352.1.97802 WP_001033352.1.97822 WP_001033352.1.97825 WP_001033352.1.97871 WP_001033352.1.97895 WP_001033352.1.97930 WP_001033352.1.97932 WP_001033352.1.97937 WP_001033352.1.97962 WP_001033352.1.97996 WP_001033352.1.98012 WP_001033352.1.98026 WP_001033352.1.9803 WP_001033352.1.98046 WP_001033352.1.98082 WP_001033352.1.98083 WP_001033352.1.981 WP_001033352.1.98115 WP_001033352.1.98139 WP_001033352.1.9816 WP_001033352.1.9817 WP_001033352.1.98176 WP_001033352.1.98187 WP_001033352.1.98205 WP_001033352.1.98208 WP_001033352.1.98220 WP_001033352.1.98232 WP_001033352.1.98239 WP_001033352.1.98241 WP_001033352.1.98244 WP_001033352.1.98279 WP_001033352.1.98284 WP_001033352.1.98292 WP_001033352.1.98294 WP_001033352.1.98301 WP_001033352.1.98312 WP_001033352.1.98355 WP_001033352.1.98357 WP_001033352.1.98384 WP_001033352.1.98400 WP_001033352.1.98424 WP_001033352.1.9844 WP_001033352.1.98442 WP_001033352.1.98451 WP_001033352.1.98477 WP_001033352.1.98498 WP_001033352.1.98549 WP_001033352.1.98569 WP_001033352.1.98578 WP_001033352.1.9858 WP_001033352.1.98587 WP_001033352.1.98628 WP_001033352.1.98641 WP_001033352.1.98665 WP_001033352.1.98668 WP_001033352.1.98683 WP_001033352.1.98702 WP_001033352.1.98776 WP_001033352.1.9883 WP_001033352.1.98886 WP_001033352.1.98908 WP_001033352.1.98920 WP_001033352.1.98976 WP_001033352.1.98988 WP_001033352.1.99029 WP_001033352.1.99046 WP_001033352.1.99053 WP_001033352.1.9907 WP_001033352.1.99101 WP_001033352.1.99110 WP_001033352.1.99182 WP_001033352.1.99209 WP_001033352.1.99234 WP_001033352.1.99265 WP_001033352.1.99292 WP_001033352.1.99295 WP_001033352.1.99302 WP_001033352.1.99304 WP_001033352.1.99334 WP_001033352.1.99345 WP_001033352.1.99361 WP_001033352.1.99392 WP_001033352.1.99400 WP_001033352.1.99427 WP_001033352.1.99446 WP_001033352.1.99453 WP_001033352.1.99475 WP_001033352.1.99486 WP_001033352.1.99487 WP_001033352.1.99501 WP_001033352.1.99511 WP_001033352.1.99534 WP_001033352.1.99562 WP_001033352.1.99592 WP_001033352.1.99602 WP_001033352.1.99603 WP_001033352.1.99632 WP_001033352.1.99641 WP_001033352.1.99666 WP_001033352.1.99692 WP_001033352.1.99774 WP_001033352.1.99791 WP_001033352.1.99827 WP_001033352.1.99869 WP_001033352.1.99912 WP_001033352.1.99929 WP_001033352.1.99986 YP_006779606.1.12065 gi|407482457|ref|YP_006779606.1| gi|90111235|ref|NP_415724.2| gi|209397423|ref|YP_002270140.1| gi|387620919|ref|YP_006128546.1| gi|407468876|ref|YP_006784682.1| gi|218694720|ref|YP_002402387.1| gi|260854867|ref|YP_003228758.1| 316385.ECDH10B_1259 316407.ychM 413997.ECB_01181 444450.ECH74115_1687 511145.b1206 544404.ECSP_1596 573235.ECO26_1719 585034.ECIAI1_1227 585055.EC55989_1302 585395.ECO103_1308 585396.ECO111_1535 595496.BWG_1031 gi|260867611|ref|YP_003234013.1| gi|386708995|ref|YP_006172716.1| gi|238900437|ref|YP_002926233.1| gi|387611769|ref|YP_006114885.1| gi|291282231|ref|YP_003499049.1| gi|410483009|ref|YP_006770555.1| gi|387506338|ref|YP_006158594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]