SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A071I3R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A071I3R1
Domain Number 1 Region: 10-283
Classification Level Classification E-value
Superfamily Terpenoid synthases 8.78e-53
Family Squalene synthase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A071I3R1
Sequence length 286
Comment (tr|A0A071I3R1|A0A071I3R1_AGRRH) Phytoene synthase {ECO:0000313|EMBL:KEA06953.1} KW=Complete proteome OX=359 OS=Agrobacterium rhizogenes. GN=CN09_08245 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MTTDAAPRSNQDLCLATLRDTDRDRYLACLLAPEDKRGALAALYAFNAELARIRDLVHEP
LPGEVRMQYWRDLLEGQAHGSSAANPVAAELLTTIDQYRLPTQTLIDMIDARIFDLYDDP
METRGTLEGYAGETASALIQLASLVLSAEDARRSADAAGHAGVAQAIAGLLLLTPLHRRR
GQLYLPLEILTATGLDRDTFLTGEDKLRISAAIEAFAGLGREHLAKARAAGSISPAVFPA
FLPVVLAEPVLKRAQKLGARVFDQAFQPPQWRRQMRMALAAMTKKI
Download sequence
Identical sequences A0A071I3R1 J2DBG5
WP_007690978.1.25048 WP_007690978.1.39766 WP_007690978.1.49937 WP_007690978.1.78634 WP_007690978.1.85071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]