SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A071MHW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A071MHW3
Domain Number 1 Region: 202-344
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.54e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.0063
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.4e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0075
Further Details:      
 
Domain Number 3 Region: 100-222
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000000305
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0043
Further Details:      
 
Domain Number 4 Region: 350-441
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000249
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A071MHW3
Sequence length 454
Comment (tr|A0A071MHW3|A0A071MHW3_9BURK) Precorrin-3B synthase {ECO:0000313|EMBL:KEA60250.1} KW=Complete proteome OX=95486 OS=Burkholderia cenocepacia. GN=DT99_07380 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MRPSACPGLVRVVAAADGGLCRVKLPGGRLDARQARAIAAAARAYGSGAIDATNRANLQL
RGIRDSAADALTRALLEAGLGPRVDAAAGAVDETAALAASDDVRNLLLSPLAGHDPAALV
DSRALAMPLLDMLAGEPRRGELSPKFSIQLDGGEAVAALDHPHDIWLAAWRRADGAVRVA
AGLAGCPPVAQDDRPASVDVSPDQAVALVRALLLAFLDLAPAEVTRMRGVLATAGECALL
ARAQHYLPFPLTADPALAGWRRTRTDPALRFGMRASRDAACCSVGAQCVLGRLDATQLER
LAALAEADGDGTLSMTPWQGVFLHGVPNERAPATLAALASLGLVCASSDPLATLVACTGS
TGCAKARADTKHDALALAARIGHPVDVHLTGCERHCALPHPAAHTLVAVAPAHYDLYRRD
AAAGLGAPLARHLTIDQAAARLTDARHSQDTTDA
Download sequence
Identical sequences A0A071MHW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]