SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072C3V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072C3V5
Domain Number 1 Region: 205-389
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.67e-71
Family Methylesterase CheB, C-terminal domain 0.000000555
Further Details:      
 
Domain Number 2 Region: 33-139
Classification Level Classification E-value
Superfamily CheY-like 3.56e-26
Family CheY-related 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072C3V5
Sequence length 395
Comment (tr|A0A072C3V5|A0A072C3V5_RHILP) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1408223 OS=Rhizobium leguminosarum bv. phaseoli CCGM1. GN=RLPCCGM1_c2635 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MRVALCLAKPLCALLGKTASHFSGIAPGAFMAKKIRVLIIDDSASIRQTLAHVLEQDPDI
EIMAVASDPFVAARKLLEEIPDVITLDVEMPRMDGITFLRKLMAQRPIPVVMCSSLTEAG
SQTLIQALEAGAVDVILKSKIGAADSLSDDAIRIREIVKSASHARLPTVRRAAGTVRSAS
ADGPAKKLTADAMLPPPTGRAMAKTTEMVVCVGASTGGTEALREFLEELPANAPGMVIVQ
HMPEKFTDAFAKRLNGLCEVEVKEAVDGDPVLRGHVLIAPGDKHTLLERQGARYHVSVKT
GPLVSRHRPSVDVLFRSAARSAGSNAMGIIMTGMGDDGARGMLEMHQAGAYTVAQDEASS
IVFGMPKEAIAKGGVDRVLPLDQIAREVMLTQQKF
Download sequence
Identical sequences A0A072C3V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]