SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072D1S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072D1S9
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily DsrEFH-like 0.000000203
Family DsrEF-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072D1S9
Sequence length 116
Comment (tr|A0A072D1S9|A0A072D1S9_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KEC86208.1} KW=Complete proteome OX=1485002 OS=Acinetobacter sp. ETR1. GN=DT74_07225 OC=Moraxellaceae; Acinetobacter.
Sequence
MNTVLVVITQANLNTLQVHESLSATMVLATFGSKVKVLLKDAGLSLLKSEMAFSQLNHVF
KLASNLVDSFEFYDLTPVLVENMNKSSAFVTQSQQELEFVELNAEFIQSFDHVLYW
Download sequence
Identical sequences A0A072D1S9
WP_034610425.1.55951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]