SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072P8D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072P8D8
Domain Number 1 Region: 330-519
Classification Level Classification E-value
Superfamily MIR domain 7.85e-51
Family MIR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072P8D8
Sequence length 780
Comment (tr|A0A072P8D8|A0A072P8D8_9EURO) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KEF51815.1} KW=Complete proteome; Reference proteome OX=1182545 OS=Exophiala aquamarina CBS 119918. GN=A1O9_12152 OC=Exophiala.
Sequence
MSTPNSTLRQRAGKEKNKGLSNGDTASDEALNKAFIQAQQSKPNEWDYKLALGIIATLAF
ITRFFGISHPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFIGWVVGYDGHFLF
DNIGESYIANNVPYVAFRSVPAFLGALTVVVVFLIMWESGYSLPACVLAASLVLFDNSHV
GQTRLILLDATLVFFMSLSILAYVKFYKQRHDPFGRKWWKWLLLTGFCMSCVISTKYVGA
FSFFTIGCAVLIDLWDLLDVKRKGGALDLFTFGKHFAARAVGLIIIPFFFYLFWFQVHFA
VLTRSGPGDDFMTPEFQETLSDNLMHQASIDIQYYDTIVLRHKDTKTYLHSHPDKYPLRY
DDGRISSQGQQVTGYPFNDTNNHWQILPNTQHPDGSHVGAPVLNGDVVKLRHVVTDTFLL
THDVASPYYPTNQEFTTVALDAASGDRHNDTLFEIKLEQGKKTTPFKSKSGQFKLIHYPS
KVAMWTHTSPLPEWAFKQAEINGNKNAQQSSNIWYVDDIPSIPEDSPRLLKDQKKVKHLP
FYIKYIELQRAMFYHNNALTASHPYATQPYSWPFLLRGVSFWTQDSTKQQIYFLGNPIGY
WIASALLAVFAGILGADQLSLRRGVDALDRRTRSRLYNSTGFFFLCWAAHYFPFYLMGRQ
LFLHHYLPAHLASCLVTGALVEFIFNVDPVLDDDMSATINSKKDKVVSKVPEKARRSFQT
AQERLKGQSLLTTWIATGVVITAVLYGFYFFFPLTYGWPGLTPDQVNARKWLFYDLHFAK
Download sequence
Identical sequences A0A072P8D8
XP_013254405.1.5891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]