SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072TC52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072TC52
Domain Number 1 Region: 50-174
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.35e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.0000194
Further Details:      
 
Domain Number 2 Region: 4-50,175-229
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.69e-30
Family RNA polymerase alpha subunit dimerisation domain 0.0003
Further Details:      
 
Domain Number 3 Region: 254-327
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 4.05e-27
Family C-terminal domain of RNA polymerase alpha subunit 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072TC52
Sequence length 332
Comment (tr|A0A072TC52|A0A072TC52_9BURK) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=180282 OS=Delftia tsuruhatensis. GN=BI380_19465 OC=Comamonadaceae; Delftia.
Sequence
MQTNLLKPKTINVEQLGHNRAKVVLEPFERGYGHTLGNALRRVLLSSMVGYAATEVTIAG
VLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGEGVVTARDIQTPHDVEI
INPDHVIANLSQGGKLDMQIKVEKGRGYVPGNVRRYGDESTKSIGRIVLDASFSPVKRVS
YAVESARVEQRTDLDKLVVEIETNGAITAEDAVRASAKILVEQLAVFAQLDGGDIASVFD
APAGGRGAATAFDPILLRPVDELELTVRSANCLKAENIYYIGDLIQRTENELLKTPNLGR
KSLNEIKEVLASRGLTLGMKLENWPPAGLEKR
Download sequence
Identical sequences A0A031I9Q9 A0A072TC52 A0A080NKX5 A0A081JDG2 A0A1C7LK55 A0A1H3EUN3 A0A210VWZ0 A0A2G6U2D5 A0A2G6W320 A0A2G7T3F7 A9BRX5 F6B191 S2WAM6 S2X1X7
gi|160896495|ref|YP_001562077.1| 398578.Daci_1047 gi|333917067|ref|YP_004490799.1| WP_012202978.1.14625 WP_012202978.1.15632 WP_012202978.1.1853 WP_012202978.1.21606 WP_012202978.1.21876 WP_012202978.1.32055 WP_012202978.1.33911 WP_012202978.1.37708 WP_012202978.1.44721 WP_012202978.1.52897 WP_012202978.1.54325 WP_012202978.1.66548 WP_012202978.1.69781 WP_012202978.1.76905 WP_012202978.1.8197 WP_012202978.1.82428 WP_012202978.1.86732 WP_012202978.1.89816 WP_012202978.1.93318 WP_012202978.1.99124 WP_012202978.1.99347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]