SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072UBJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072UBJ6
Domain Number - Region: 40-89
Classification Level Classification E-value
Superfamily MIR domain 0.0314
Family MIR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072UBJ6
Sequence length 196
Comment (tr|A0A072UBJ6|A0A072UBJ6_MEDTR) Avr9/Cf-9 rapidly elicited protein {ECO:0000313|EMBL:KEH27184.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_6g088545 OC=Trifolieae; Medicago.
Sequence
MEIETNQAMVVTKKVWNTLRIILFMFTKNIAKSKMVAQLNLLLKRSKLAAIKAIANTLAL
RHHSTASFVSPHDYEFSCSNSPTAIKFHSKNNNYHRGRHHNDVSTIQKVLEILNDIDVSS
FSSPSPLVAFPGFGKSPIGKKIRVTDSPFPLKEEEGDDHSHVDVAAEEFIKRFYKNLKLQ
QKLVAIQSPYNNSHNR
Download sequence
Identical sequences A0A072UBJ6
XP_013453156.1.50012 Medtr6g088545.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]