SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072UL06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072UL06
Domain Number - Region: 32-155
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00412
Family ThuA-like 0.076
Further Details:      
 
Domain Number - Region: 264-379
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0107
Family Capz alpha-1 subunit 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072UL06
Sequence length 434
Comment (tr|A0A072UL06|A0A072UL06_MEDTR) Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit {ECO:0000256|RuleBase:RU361142} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_4g069240 OC=Trifolieae; Medicago.
Sequence
MAKLIIFLFLTLIPILCNSFTPDKPSDRRILVLLDDFAIKSSHSLYFKSLQSRGFDLDFK
LADDPKIALQRYGQYLYDALVLFSPTIERFGGSIDAAAILAFVDSGHDLIVAADSNASDL
IREIATECGVDFDEDYGAVVVDHAGYAVSATEGDHTLIASDDFIKSDVILGSKKIEAPVL
FQGIAHSLNPSNSLVLKVLSASPTAFSANPKSKLTSPPSLLGSSISLVSVIQARNNARIL
ISGSLSMFSNRFFNSGVQKAGSPTKHDKSGNEQFLTEVSKWVFHERGHLKAVNVQHHKVG
ETNEPSIYRINDDLEYSVEIYEWSGTTWEPYVADDVQVQFYMMSPYVLKTLSNDNKGRYF
TSFKVPDVYGVFQFKVEYDRLGYTSLSLAKQIPVRPFKHNEYERFIPAAYPYYGAAFSMM
AGFFVFSAVHLYNK
Download sequence
Identical sequences A0A072UL06
XP_013456378.1.50012 Medtr4g069240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]