SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072URB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072URB5
Domain Number 1 Region: 59-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000255
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072URB5
Sequence length 199
Comment (tr|A0A072URB5|A0A072URB5_MEDTR) Transmembrane protein, putative {ECO:0000313|EMBL:KEH32237.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_4g117740 OC=Trifolieae; Medicago.
Sequence
MRLGSLDNQRNSVENPIVHVRSKLCSDANGVNLKETHYKKMLGSLGYISAAPPDMIFVFV
GVVMLPSMFGHDFGNQIGRYATLVDPNSNEFQVLVERPNGCIYLAKGWHALRDFYNLSLG
GWVTIVFLGQGRFKIRIKDRPVPSAFAHDLMNFQYAYEKRLSGDEIKNGCMNLAYSGFCE
LALDVNAAALVMVDECGNQ
Download sequence
Identical sequences A0A072URB5
Medtr4g117740.1 XP_013458206.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]