SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072V0K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072V0K2
Domain Number 1 Region: 533-651
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-20
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072V0K2
Sequence length 659
Comment (tr|A0A072V0K2|A0A072V0K2_MEDTR) High affinity sulfate transporter type 1 {ECO:0000313|EMBL:KEH34873.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g073780 OC=Trifolieae; Medicago.
Sequence
MSPMDSPTDKHIDTNKMDERSLSASHDQQPYAYKVAIPPKQNLFKEFQYTVKETFFADDP
LRSFKDQSTSKKLILGIEFIFPILNWGRSYNLKKFRGDIIAGLTIASLCIPQDIGYSKLA
HLAPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLSNEIDPVTHAEEYRRLA
FTATFFAGITQATLGIFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKTKMFTT
KTDIISVLKAVFSSAKHGWNWETILIGASFLSFLLVAKFIGKKNKKFFWVPAIAPLISVV
LSTFFVFITRADKQGVEIVNHIEKGINPSSVHEIYFSGDYLGKGFKIGVMAGMIALTEAI
AIGRTFASMKDYQLDGNREMVALGTMNVVGSMTSCYVATGSFSRSAVNYMAGCQTAVSNI
VMSIVVFLTLQFITPLFKYTPNAILAAIIISAVISLVDYQAAILIWKTDKFDFVACMGAF
FGVVFVSVEIGLLIAVSISFAKILLQVTRPRTAILGKIPGTSVYRNIQQYTEASKVPGVM
IVRVDSAIYFSNSNYVKERILRWLTDEEAVKGDYHTRIQFLIVEMSPVTDIDTSGIHAFE
ELHRSLEKRGVQLVLANPGSAVTDKLYTSNFANIIGQDNIFLTVAAAVANCAPKLDVNP
Download sequence
Identical sequences A0A072V0K2
XP_013460839.1.50012 Medtr3g073780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]