SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072V3I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072V3I2
Domain Number 1 Region: 38-135
Classification Level Classification E-value
Superfamily MIR domain 3.92e-34
Family MIR domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072V3I2
Sequence length 158
Comment (tr|A0A072V3I2|A0A072V3I2_MEDTR) Stromal cell-derived factor-like protein {ECO:0000313|EMBL:KEH35903.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g106130 OC=Trifolieae; Medicago.
Sequence
MALGFFALAIFLFLTLDPDVSPSSTASASAASSEGVEVQITYGSVIKLMHEKTKFRLHSH
DVPYGSGSGQQSVTGFPSVDDANSYWIVRPEPGTSAKQGDTIKSGTIIRLQHMRTRKWLH
SHLHASPISGNLEVCFLFFLLQVFITIYALGFVGDCFL
Download sequence
Identical sequences A0A072V3I2
Medtr3g106130.3 XP_013461868.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]