SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072Z7G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072Z7G7
Domain Number 1 Region: 421-529
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000019
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072Z7G7
Sequence length 537
Comment (tr|A0A072Z7G7|A0A072Z7G7_CORGT) MFS transporter {ECO:0000313|EMBL:KEI22607.1} KW=Complete proteome OX=1079988 OS=Corynebacterium glutamicum ATCC 14067. GN=KIQ_008485 OC=Corynebacterium.
Sequence
MRDLLPSRDDYQLLRFSWKMDIAAGVTVGIVALPLALAFGVSSGVGAEAGLVTAIIAGLV
AAIFGGSNVQVSGPTGAMVVILAPIVAQYGVGAVALLSLMAGVIVLVAGVLRLGRTVSFI
PWPVIEGFTAGIGVIIFLQQVPAAFGYSGHLPTNALLAAIHTVSHATKDAILPLLIIIVT
AAIMIVLGKIAPKLPASFIAILVVSIGVALLKLPVELIGELPNSLPAPHLPDVNLEMFTS
LLGPAFAVAALAAIESLLSARVAASMADTGPYNADRELVGQGLASISAGFFGGMPATGAI
ARTAVNVRSGGRTRMASIIHALVLLGVVYVAANIVAVIPLAALSGVLMVTASRMVSIEVI
SRVMRSTRSDAIVFVITAIVTISVDLVIAVGIGIAVAAFFILRRMSMNAGVFRETLPEPA
TLNDEKIGLFRIEGALFFGAAERLSQQILDYDDLEVVILRLSHIQMIDATGAHQLTELVN
ALERKNVTVLIKGVRKEHIHVLGVLGAIRSLRHQNHLFDDLAPAVEHARKHVKIDNS
Download sequence
Identical sequences A0A072Z7G7 A0A0F6Z536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]