SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073CGN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073CGN9
Domain Number 1 Region: 107-272
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.41e-23
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 223-371
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00079
Further Details:      
 
Domain Number 3 Region: 15-99
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.49e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 
Domain Number 4 Region: 377-459
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000000445
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073CGN9
Sequence length 491
Comment (tr|A0A073CGN9|A0A073CGN9_PLAAG) NirA {ECO:0000313|EMBL:KEI66813.1} KW=Complete proteome; Reference proteome OX=388467 OS=Planktothrix agardhii NIVA-CYA 126/8. GN=A19Y_1820 OC=Microcoleaceae; Planktothrix.
Sequence
MFLTNSLRRMEKKIIVNWLVKANVCPGLFYGTPAQDGFLIRIRTPGGWLNSKQGALIAQL
LKAWGSEALQVTNRGNLQIRGVQNPPSLEVLQTLQNLGLAAFDPRIDHLRNIMASPTAGI
DPQELIDTRPLVQKLDYFIQNHPSIIELSPKFSIGIDGGGKVGIGTRSPIVWEHRYNEIQ
LLAITIDDHINSTSDLYFQLALGGDKNLYHTSILIRLENCLSVVAALVKVYIDYVQQNPL
QTGKKPRMKHLLKDWGVENYLEAVKAELEYPLNLIFDPEKTVLKTVNPLPSQPYAHLGIH
PQRQAKLSYLGLSLKLGKLSADQLLELVEISETFGSGQLRLTPWQTILIPDIPNQKIPEL
LPKLAPFGLSNSLVDAGIVACAGKPGCAAAATETQIHALILADDLKEQLTLNSPVNIHLT
GCDKLCAQPSPAEITLLGTIIEQNGKKVEGYQVYIGKGQDSLNHKVCEEKLVDILPLIKK
VCVDLNKTKPE
Download sequence
Identical sequences A0A073CGN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]