SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073CLD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073CLD2
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-26
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073CLD2
Sequence length 109
Comment (tr|A0A073CLD2|A0A073CLD2_PLAAG) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=388467 OS=Planktothrix agardhii NIVA-CYA 126/8. GN=A19Y_4265 OC=Microcoleaceae; Planktothrix.
Sequence
MSSDVKILKPNGILDGTKASQFRQDIVALVEKGAKIILIDFQDVTFMDSSGLGALVLALK
GVRAAGSKLFVCSINEQIKILFELTSMDRVFEIFENQEKFLEVIIQLGQ
Download sequence
Identical sequences A0A073CLD2 A0A1J1JEQ5 A0A1J1L849
WP_026797310.1.12950 WP_026797310.1.39352 WP_026797310.1.54954 WP_026797310.1.64819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]