SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073IF28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073IF28
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily TrpR-like 3.35e-22
Family SPO1678-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A073IF28
Sequence length 92
Comment (tr|A0A073IF28|A0A073IF28_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KEJ88374.1} KW=Complete proteome; Reference proteome OX=1300350 OS=Sulfitobacter donghicola DSW-25 = KCTC 12864 = JCM 14565. GN=DSW25_14835 OC=Rhodobacteraceae; Sulfitobacter.
Sequence
MYLKKVDGPRAVTLADGTVMTSADLPPTKTRRWVASRKAAVVRGVVYGLITKDDALKRYS
LSDDEFIEWVRAVSTHGEAALKTTMVQKYRQL
Download sequence
Identical sequences A0A073IF28
WP_025060769.1.3964 WP_025060769.1.50323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]