SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073J313 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073J313
Domain Number 1 Region: 14-80
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000000693
Family F1F0 ATP synthase subunit C 0.0095
Further Details:      
 
Domain Number 2 Region: 94-162
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000000327
Family F1F0 ATP synthase subunit C 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A073J313
Sequence length 166
Comment (tr|A0A073J313|A0A073J313_9BACT) Permease {ECO:0000313|EMBL:KEJ92092.1} KW=Complete proteome; Reference proteome OX=2754 OS=Synergistes jonesii. GN=EH55_05560 OC=Synergistes.
Sequence
MESILATMGDQLGQMLVVLGGALAVGFAGSGSAWGIGLANEAAAGIMTEDPKKFGYALVL
LALPGTQGIYGLLVAVLAMQKAGLLGGGSVALTVWQGFGICCACLPIAIAGFYSAIWQGK
SSAATILMIAKRPEQIGKAVILPAMCETYAVFGLLVSILMLNGIKL
Download sequence
Identical sequences A0A073J313
WP_037976456.1.27388 WP_037976456.1.38845 WP_037976456.1.80082 WP_037976456.1.88412 WP_037976456.1.9341 WP_037976456.1.99894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]