SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073J6F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073J6F7
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A073J6F7
Sequence length 112
Comment (tr|A0A073J6F7|A0A073J6F7_9RHOB) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1402135 OS=Sulfitobacter pseudonitzschiae. GN=SUH3_11025 OC=Rhodobacteraceae; Sulfitobacter.
Sequence
MELSSKTEGQVQIVAVLGTRIDAAVAIEFKDAMRAETANGPDLVILDLSAVDFIDSSGLG
AIVAAMKHLAPQRRLALAGLTPTVDKVFKLTRMDSVFSLYPTLDDARNALVA
Download sequence
Identical sequences A0A073J6F7
WP_037923164.1.46491 WP_037923164.1.99201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]