SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073J7Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073J7Y2
Domain Number 1 Region: 713-913
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.28e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 
Domain Number 2 Region: 435-619
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000244
Family Pyruvate oxidase and decarboxylase PP module 0.063
Further Details:      
 
Domain Number 3 Region: 17-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000353
Family Pyruvate oxidase and decarboxylase Pyr module 0.05
Further Details:      
 
Domain Number 4 Region: 266-347
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000471
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A073J7Y2
Sequence length 1139
Comment (tr|A0A073J7Y2|A0A073J7Y2_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KEJ97920.1} KW=Complete proteome; Reference proteome OX=1402135 OS=Sulfitobacter pseudonitzschiae. GN=SUH3_02735 OC=Rhodobacteraceae; Sulfitobacter.
Sequence
MSTQKISLNDRYNLDRDTVLLNGTQALVRLMMMQKARDRAAGLNTAGLVTGYRGSPLGAV
DLQMMRAAKPLAEHDVTFQPGLNEDLAATALWGSQQAELRGEGKYDGVFGLWYGKGPGVD
RSGDVFKHANMAGSSKHGGVLVAMGDDHTGESSTVLHQSEFALLDAYMPVVSPAGVQEIM
DYGLYGWALSRFSGLWVGLKTMKDTIEATSVVNGNPNRLNFVVPEFNMPKGGLNIRLVDT
PVEQETRVIDHKRFAAEAFSRANGMDKRVWGKPGAKIGFVAAGKNWLDLMHAMDLLHIDE
NEAERLGITTYKVGQTWPLDMDTFHEWAAGLDLIVVVEEKRKLIEVQIKEAIFDDRDGRR
VYGWHKGDTWEHGRRLELFPTRGALDPILIAEKLGDILIEEGRNTDGIQAGLASLSEARR
NDNAQDLAARLPYFCSGCPHNTSTKLPDGSRAYAGIGCHYMVQWMDRGTVGYTHMGGEGA
NWIGEAPFSTTDHVFQNLGDGTYNHSGVQAIRAALASKANITYKILYNDAVAMTGGQANE
GGLSAYKIVDELRAMGVPTIEVVYDEKEDVDLARFKGIPTHERSELDAVQKRLREVKGVS
AIVYIQTCAAEKRRRRKRGTFPDPDKRVFINTDVCEGCGDCGVQSNCVSIVPKETELGRK
RAIDQSSCNKDFSCLKGFCPSFVTLEGAQVRKDPTTKLDLPDLPEPTLPAIDGTFNVVIT
GVGGTGVVTVGAVMAQAAHIDGKGAGMMEMAGLAQKGGAVHIHCRLANQPDDITAIRVAT
GEADALIGGDLVVSAGAKTLGLTSTGRTGAVVNSHEIITGDFTRDTEFTLPADRLKLALE
ARLQDRVAMFDASDLAKAVLGDSIYSNMMLMGAAWQRGLLPLTHAAIVEAVTLNGAAVER
NLRAFEIGRWAVLYPDQVQNILTPKVVALPKTLDEKIAYRADHLVKYQGKRLANRYRKMV
EGIEDRTVRAAVAEGYHKVLAYKDEYEVARLLQSTRAKAEAEFDGDFTMKYHMAPPVLTK
MGTDGRPVKRTFGPWLEKPLAVMARFKGLRGTPLDVFGYTTERRMERALITQYEADMKQV
LPLLTDDTREAIVALAELPKSIRGFGPVKQANEAKAAKRREELLAVIRAGGGDMAKAAE
Download sequence
Identical sequences A0A073J7Y2
WP_037921172.1.46491 WP_037921172.1.99201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]