SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073JAP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073JAP3
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily TrpR-like 2.09e-22
Family SPO1678-like 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073JAP3
Sequence length 96
Comment (tr|A0A073JAP3|A0A073JAP3_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KEJ94797.1} KW=Complete proteome; Reference proteome OX=1402135 OS=Sulfitobacter pseudonitzschiae. GN=SUH3_05085 OC=Rhodobacteraceae; Sulfitobacter.
Sequence
MYLKKVDGPRAVTLLDGSVMTQADLPDAGTRRWVASRKAAVVRGVLYGLIGQAAALQRYD
ISAEEFAEWVRAVSLHGEEALKATALQRFRRPKAGS
Download sequence
Identical sequences A0A073JAP3
WP_037928831.1.46491 WP_037928831.1.99201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]