SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073K2T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073K2T9
Domain Number 1 Region: 196-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.45e-74
Family PFOR Pyr module 0.017
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0027
Further Details:      
 
Domain Number 3 Region: 468-577
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.13e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073K2T9
Sequence length 585
Comment (tr|A0A073K2T9|A0A073K2T9_9BACI) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KEK20772.1} KW=Complete proteome; Reference proteome OX=574376 OS=Bacillus manliponensis. GN=BAMA_08240 OC=Bacillus cereus group.
Sequence
MISQLSWKVGGQQGEGIESTGEIFCIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTE
VRAVSDDLDILIAFDQETIDFNFHELRSGGIVVADAKFNPTIPEGTNVTLYAIPFTEIAS
ELGTSLMKNMVAVGASSAVLGLDENVYLEVVNEIFGRKGEQIVEKNMEAIKRGSQYMKEL
LGENVNMMQLEKADGQKRMFMIGNDAIAFGAVAGGCRFMSAYPITPASEIMEYLIKKLPK
VGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGMTEIPLVIVDTQ
RGGPSTGLPTKQEQSDLLAMIYGTHGEIPKIVMAPSTVEEAFYDAIEAFNLAEEYQVPVI
LLTDLQLSLGKQTVEPLKLDKVEIRRGKLDLQAELPEQENKAYFKRYEVTEDGISPRILP
GTKNGIHHVTGVEHDETGKPSESALNRKQQMDKRFRKMENLKFNTPIYKNAKHDEADVLL
VGFNSTRGAIEEAMGRLEQDGLKVNHAHIRLIHPFPTNELLPLVQHAKRVVVVENNATGQ
LANIMKMNLGSGEKISSLLKYDGNPFLPKEIYNECKEGVVLNGNI
Download sequence
Identical sequences A0A073K2T9
WP_034635657.1.33474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]