SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073KL21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073KL21
Domain Number 1 Region: 415-497
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073KL21
Sequence length 519
Comment (tr|A0A073KL21|A0A073KL21_9GAMM) Sulfate transporter {ECO:0000313|EMBL:KEK27969.1} KW=Complete proteome OX=332186 OS=Shewanella xiamenensis. GN=SXM_2359 OC=Shewanellaceae; Shewanella.
Sequence
MFDLFRHKTSSYKADILSGLTVALALIPEAVAFAFVANVEPMVGLYAAFIMGLVTALIGG
RPGMISGATGAMAVVMVSLVVEHGVQYLFAAVVLAGLIQISAGIFKLGKFIRIVPYPVMI
GFVNGLAIVIFLAQLGQFKVKDTAGNLVWLPPEPLLLMLGLVALTMAIIYFLPKLTTAIP
SSLVAILSVTAIVVSFDLDTRNVLDFLKTMSGDENATIAGSLPSFAIPQVPFNLETLYII
LPYSFILAAVGLIESLLTLTVIDEMTHTRGRSNKECIGQGVGNITSGFFGAMGGCAMIGQ
SMININSGGRGRLSGITAAIGLLAFILFGAAFIEIIPLAALVGVMFIVVLGTFEWASFKF
MGKVPKHDAFVIVLVTTVTVFTDLAFAVFVGVVVSALVFAWQHAKHISVKVTQNSQGWKV
YELNGPLFFGSVASFLELFDASQDPQDVVIDFKFSRVADHSALEAIDTLAERYVSIGKRL
HLVHLSADCKALLHKAGDLVEVNLLDDPHYKVADDKLDS
Download sequence
Identical sequences A0A073KL21
WP_037419676.1.37160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]