SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073KMQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073KMQ0
Domain Number 1 Region: 75-100
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000602
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A073KMQ0
Sequence length 105
Comment (tr|A0A073KMQ0|A0A073KMQ0_9GAMM) Zinc-finger-like domain-containing protein {ECO:0000313|EMBL:ODR87748.1} KW=Complete proteome OX=332186 OS=Shewanella xiamenensis. GN=ABT47_22095 OC=Shewanellaceae; Shewanella.
Sequence
MEERKTLIAGGNLLQAHTWKGLLEACGIHVELRGEALLGGVGELPANLHNVELWVRESQL
ANAQAQLSGLDVVSPQWQCVQCHEMNEGSFELCWHCSAERSESHN
Download sequence
Identical sequences A0A073KMQ0 A0A0P7KGT0 A0A1Z4A7C5
WP_037420242.1.29358 WP_037420242.1.37160 WP_037420242.1.63360 WP_037420242.1.71831 WP_037420242.1.72131 WP_037420242.1.74954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]