SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A073L5B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073L5B4
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-21
Family Sfri0576-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073L5B4
Sequence length 121
Comment (tr|A0A073L5B4|A0A073L5B4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KEK29803.1} KW=Complete proteome OX=332186 OS=Shewanella xiamenensis. GN=ABT47_05590 OC=Shewanellaceae; Shewanella.
Sequence
MLCQIPDIAKGVISLFASGRLSSTDYRTRLQPAIKSYRKDWGQVCLYIEADVLLEGWEFE
SLTGSGEVQLPNFEALVFVGGPDWVGNAVRLLGPFMQGEVAWFPLEQKAKAIAWIAKRST
F
Download sequence
Identical sequences A0A073L5B4 A0A0P7JHF2 A0A1Z4ADC9 V1DFD8
WP_023268861.1.101270 WP_023268861.1.29358 WP_023268861.1.37160 WP_023268861.1.63360 WP_023268861.1.71831 WP_023268861.1.72131 WP_023268861.1.74954 WP_023268861.1.77687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]