SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073UCN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073UCN9
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily TrpR-like 0.000000000194
Family SPO1678-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A073UCN9
Sequence length 59
Comment (tr|A0A073UCN9|A0A073UCN9_ECOLX) Helix-turn-helix domain protein {ECO:0000313|EMBL:KEL65411.1} KW=Complete proteome OX=1444047 OS=Escherichia coli 5-366-08_S1_C1. GN=AB08_4880 OC=Enterobacteriaceae; Escherichia.
Sequence
MKHSFEVKLAAVNHYLAGHAGIISTAKLFQLSHTSLSHWINLFLLHGPRALDCRHCQRQ
Download sequence
Identical sequences A0A073H9X9 A0A073UCN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]