SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074JU22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074JU22
Domain Number 1 Region: 714-916
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0053
Further Details:      
 
Domain Number 2 Region: 19-204
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000412
Family Pyruvate oxidase and decarboxylase Pyr module 0.055
Further Details:      
 
Domain Number 3 Region: 435-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000113
Family Pyruvate oxidase and decarboxylase PP module 0.065
Further Details:      
 
Domain Number 4 Region: 265-350
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000262
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074JU22
Sequence length 1136
Comment (tr|A0A074JU22|A0A074JU22_9RHOB) MFS transporter {ECO:0000313|EMBL:KEO61156.1} KW=Complete proteome; Reference proteome OX=1353528 OS=Thioclava indica. GN=DT23_10500 OC=Rhodobacteraceae; Thioclava.
Sequence
MGRQEITLSDRFDLTKSPVLLNGTQALVRLVLAQAARDAAAGLHTAGYVTGYRGSPLGAV
DLQMARAKTVLEASDVRFEPGLNEDLAATALWGSQQAELRGDGKYDGVFGLWYGKGPGVD
RSGDVMRHANMAGSSPHGGVIMAMGDDHTGESSTVLHQSDWAMVDAYMPVLSPAGVQEIL
DLGHYGYALSRFAGVWVGLKTMKDTVEATAVVDGDPQRMQFVTPDFKMPEGGLNIRLNDT
PVAQEARMIDFKRFAAEAFARANRIDKRVWGKAGAKIGLVAAGKNWLDLSHALSLLGIDA
TEAERLGITTYKVAQTFPLDMDSFHEWAEGLDLVIVVEEKRKLIEVQVKETLFDDRRGRR
VYGWHKGDNWENGRRVELFPTRYALDPVMIAQKLGEIFIEEGRGTDAIKAGIAKIEAAQR
ADNAPEIAARTPWYCSGCPHNTSTKLPEGTRGYAGIGCHYMVQWMGRDTEGFTHMGGEGV
NWVGEAPFSNREHMFQNLGDGTYNHSGVQAIRAALAAGTNITYKILFNDAVAMTGGQENE
GDLSAQQIAAEITAMGVKPVVVVYDEKEEVDLSAFPSTVEKFERAELMAVQKRLAKERGV
SALIYVQTCAAEKRRRRKRGKFPDPDKRVFINTDVCEGCGDCGVQSNCVSIVPVETELGT
KRAIDQSSCNKDFRCLDGFCPSFVTLKGAKIKKAQAKDLDLPDLPMPTLPAINGTHNVVI
TGVGGTGVVTIGAVLAMAAHLDDKGAGMMEMAGLAQKGGAVHIHLRIAEKPEDISAIRVA
VGEADCVIGGDLVVSAGSKTLGLMTTGRTGAVVNSHEIVTGEFTRNRDFHLPGDQLRLSL
EARLKDRVSFVDTSELARHMLGDSIYSNMVVLGAAWQQGYIPLSLEAITRAIDLNGAKPE
ENKRAFDLGRWAMVHPEQAARAMVSEVVKAPVDPVDFRADQLVAYQNKRLAKRFRKLVDS
APDDLRVSVAKGYHKLLAYKDEYEVARLHLDTAAKARAEFDGDFEMHFHLAPPIMAKEGA
NGRPIKREFGPWIARGFKVLAKLKGLRGTPLDPFGRAAERKMERALIAQYEADMAEILPK
ITPETMEIARELAELPLSIRGYGPVKAQGEVMAAKRREALLAAFRAGGHPQPMAAE
Download sequence
Identical sequences A0A074JU22
WP_038128288.1.39045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]