SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074LUH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074LUH0
Domain Number 1 Region: 129-249
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.26e-21
Family Sfri0576-like 0.0071
Further Details:      
 
Domain Number 2 Region: 5-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-17
Family Sfri0576-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074LUH0
Sequence length 250
Comment (tr|A0A074LUH0|A0A074LUH0_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KEO85756.1} KW=Complete proteome OX=383381 OS=Erythrobacter sp. JL475. GN=EH30_14695 OC=Erythrobacteraceae; Erythrobacter.
Sequence
MIEFEQIAPHAHRITVMAEFRQADAEALAGFVKEQQASGSKGGNLLIDLTAMAGFSWSAV
AEEMVHFPLLLKWVYGLDRIAIVSDEEWVRTSARLESALLPGISYQVYDDDEAETARAWV
LEQVENPHTGAFHEIDVGNPKIAAYELSGRLDREESEKGVAMVRAKFDLDGCTRLLLVIR
NWHGFDLDRLLSGDVLNGKLEIARKMERYAIVGGPKWIRTYAEFTSNFFSGEIRGFELED
QEKAIAWLSE
Download sequence
Identical sequences A0A074LUH0
WP_034956417.1.12739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]