SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074M001 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074M001
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074M001
Sequence length 109
Comment (tr|A0A074M001|A0A074M001_9SPHN) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=383381 OS=Erythrobacter sp. JL475. GN=EH30_09105 OC=Erythrobacteraceae; Erythrobacter.
Sequence
MDWNTEQRAGAAVLAPRGRIDESTADSFKDFLLSAVEDAPAMAIIDLEKVDYMSSRGLRA
LTLAQRAGQSSGTTIVLARPNDTMREILAISRYDMVFRVADTIEDALGN
Download sequence
Identical sequences A0A074M001
WP_034955006.1.12739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]