SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074MNZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074MNZ7
Domain Number 1 Region: 454-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074MNZ7
Sequence length 585
Comment (tr|A0A074MNZ7|A0A074MNZ7_9SPHN) Sulfate:proton symporter {ECO:0000313|EMBL:KEO96681.1} KW=Complete proteome; Reference proteome OX=39960 OS=Erythrobacter litoralis. GN=EH32_08340 OC=Erythrobacteraceae; Erythrobacter.
Sequence
MLKRYLPILEWGRSYDRSVLSSDLVAAVIVTIMLIPQSLAYALLAGLPPVVGLYASILPL
VLYAIFGTSRTLAVGPVAVISLMTASAAGAVAEQGTAAYLEAAITLAFLSGIMLAILGLL
RAGFLANLLSHPVISGFITASGVLIATSQLRHILGVSGGGDNWPEMLGSIGASLGTTNPW
TLAIGIPALAFLFWVRKGAKPALMRLGIADKPADMIAKAGPVVAVALTIIAVIVFDLGEK
GVAITGEIPPGLPPFALPSADLSLIEALWVPALLISIIGFVESVSVAQTLAAKRRQRISP
DQELIGLGASNIASALSGGYPVTGGFARSVVNFDAGAQTPAAGAFTAVGIALASLFLTPL
LFSLPIATLAATIIVAVLSLVDLKTPGRLWRYSKSDFAAHVATIGITLIAGVEMGVIAGV
GVGLLLYLWRASRPHAAIVGRVPETEHFRNVDRHDVFTVPHVLSIRIDESLTYLNARWLE
EYVLARVAEKPELRHVILMCSAVNAIDASGLESLEAINHRMGDAGVGLHLSEVKGPVMDR
LKRSHFLEELNGEVFLSQSRAFETCVADNGEAREPQDHYMARGLI
Download sequence
Identical sequences A0A074MNZ7
WP_034901996.1.45511 WP_034901996.1.99002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]