SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074TFJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074TFJ7
Domain Number 1 Region: 82-142,175-264
Classification Level Classification E-value
Superfamily MIR domain 2.62e-17
Family MIR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074TFJ7
Sequence length 328
Comment (tr|A0A074TFJ7|A0A074TFJ7_HAMHA) Uncharacterized protein {ECO:0000313|EMBL:KEP67763.1} KW=Complete proteome; Reference proteome OX=99158 OS=Hammondia hammondi (Parasitic protozoan). GN=HHA_228630 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Hammondia.
Sequence
MAHSRERRSPSCLVFSLSPPTSSGQRDVSVSERREKTCDTPCESPISRLKSSASPSFSLS
SWFLLFLLFSLFCMVEGAKPKEGRPVTYGSAVSLVHVLSGFKLFSGKISWGSGSGQQAVT
ATPSGDKAAAANMLWIVSAPPSGMRRQPLDSPVMEAQTAGRKSSASSQPAPALVTPGAAG
EPVRCGSVIFLEHGSSRGTLQATGASSPISSQKEVSVGTGRDTRVAGFKLVCANTKSENW
LTGDIVTFEHVRLGTNLQAKKDHQFTQQNCGRGCPIAGHIEVSVSNEKPRSSWGWSTPPD
QWKASAGLMVNKEGEGLFDDLGFDHDEL
Download sequence
Identical sequences A0A074TFJ7
XP_008882198.1.28481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]