SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074TRF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074TRF8
Domain Number 1 Region: 21-217
Classification Level Classification E-value
Superfamily ITPase-like 2.33e-53
Family ITPase (Ham1) 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074TRF8
Sequence length 222
Comment (tr|A0A074TRF8|A0A074TRF8_HAMHA) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_03148} KW=Complete proteome; Reference proteome OX=99158 OS=Hammondia hammondi (Parasitic protozoan). GN=HHA_202300 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Hammondia.
Sequence
MAENGGVGLAATVSDDSRPLIFFCTGNANKLAEIQQILADQDVRLVAANVDLPELQGASP
AEIAEAKCRSAVRQLHLSKVDLSRNALVMVEDTCLCFNALKGLPGPYVKWFLQKLGPDGL
PNLLAAYEDKTGYALCTLCVAEIGRVTEEGGEPTFHTLEGRTDGIIVTEPRGPRTFGWDP
IFQPHGFKLTYAEMDKAVKNSISHRYKAMEALKNFLSRTMRR
Download sequence
Identical sequences A0A074TRF8
XP_008884516.1.28481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]