SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074WW64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074WW64
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-82
Family Capz beta-1 subunit 0.0000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074WW64
Sequence length 264
Comment (tr|A0A074WW64|A0A074WW64_9PEZI) F-actin capping protein {ECO:0000313|EMBL:KEQ77450.1} KW=Complete proteome; Reference proteome OX=1043004 OS=Aureobasidium namibiae CBS 147.97. GN=M436DRAFT_77337 OC=Aureobasidium.
Sequence
MADQFDSALDLLRRLNPKNTAANLSAICSLVPEHEEELLASVDQPLEVRRCKKSGRDYLL
CDYNRDGDSYRSPWSNEFDPPVDDAEMSSERVRRLEVRANEAFDVYRELYYEGGTSSVYL
WNLDDGFAGVVLLKKSSSQAAASGAWDSIHVLEVAERGRTAKYKLTSTVILNLGTKGDAL
GSLDLAGNMTRQVEADMSVDADETHVANIGKLVEDMELKMRNLLQEVYFGKAKDVVGDLR
SIPPLSEANRDRAAQREMISSMAR
Download sequence
Identical sequences A0A074WW64
XP_013432343.1.85016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]