SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074X0I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074X0I2
Domain Number 1 Region: 335-520
Classification Level Classification E-value
Superfamily MIR domain 7.72e-60
Family MIR domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074X0I2
Sequence length 742
Comment (tr|A0A074X0I2|A0A074X0I2_9PEZI) Dolichyl phosphate-D-mannose:protein O-D-mannosyltransferas-like protein {ECO:0000313|EMBL:KEQ77269.1} KW=Complete proteome; Reference proteome OX=1043004 OS=Aureobasidium namibiae CBS 147.97. GN=M436DRAFT_37469 OC=Aureobasidium.
Sequence
MAATNQGFATGADRDAAELRRRAAAPAQNGAVQQQQQPIIDDKKKQQVKSIANVIDDWEP
VFAPIIFTALAFFTRLWKIGLSPIVTWDEAHFGKFGSHYLQREFYFDVHPPLGKMLVGLS
GYLAGYNGTFEFKSGETYPEEINYVFMRQFNAAFGALCIPLAYYTAKELNFRKTTTWFVT
LMVLFENSYATISRFILLDSMLLFFTFTTVLCWARFHRLQKQPFSAQWLLWLLLSGLSIG
CVCSVKWVGMFGTALVGLYTIEDLWNKFGDLKMPKTELAAHLGFRVVGLIVIPMIVYMFS
FYMHFLILENSGPGDAQMSSLFQANLKGTEVGVDSPLEVALGSRATLKNMGYGGGLLHSH
VQTFPEGSQQQQITCYHHKDANNDWFFYPNRHEPEFDADAPLKFVGNGDTIRLIHAQTGR
NLHSHSIAAPVTKADYEVSCYGNTTVGDTKDHWVVEVVNDASSRDYTKLRTLTTAFRLRH
VDLNCYLRAGNVNLPQWGFKQIETTCVKENHPRDVYTHWNVESHWNDKLPAADTGAYKSP
FLRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLNVGLRMCGWDDHIVKYFLLGN
PFVYWASTASIPAFGLLVAYYLIRWQRGYNELSQKDIDQIHYAGIYPVIGWVLHYAPFMA
MGRVTYVHHYYPALYFAILCLAFCTDWVTSRFPRAVQYGIYAALYTVVITLFWMFRAITF
GMEGTHTQWTHLKWLESWRMTD
Download sequence
Identical sequences A0A074X0I2
XP_013430642.1.85016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]