SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074X3J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074X3J6
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-83
Family Capz beta-1 subunit 0.0000000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074X3J6
Sequence length 264
Comment (tr|A0A074X3J6|A0A074X3J6_AURPU) F-actin capping protein {ECO:0000313|EMBL:KEQ80080.1} KW=Complete proteome; Reference proteome OX=1043002 OS=Aureobasidium pullulans EXF-150. GN=M438DRAFT_368871 OC=Aureobasidium.
Sequence
MADQFDSALDLLRRLNPKNTATNLSAICSLVPEHEEELLASVDQPLEVRRCKKTGRDYLL
CDYNRDGDSYRSPWSNEFDPPVEDAEMSSERVRRLEVRANEAFDVYRELYYEGGTSSVYL
WNLDDGFAGVVLLKKSSSQTAASGAWDSIHVLEVAERGRTAKYKLTSTVILNLGTKGDAL
GSLDLAGNMTRQVEADMPVDADETHVANIGKLVEDMELKMRNLLQEVYFGKAKDVVGDLR
SIPPLSEANRDRAAQREMISSMGR
Download sequence
Identical sequences A0A074X3J6 A0A1A7MSQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]