SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074YAD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074YAD7
Domain Number 1 Region: 328-517
Classification Level Classification E-value
Superfamily MIR domain 3.14e-50
Family MIR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074YAD7
Sequence length 790
Comment (tr|A0A074YAD7|A0A074YAD7_9PEZI) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KEQ94725.1} KW=Complete proteome; Reference proteome OX=1043005 OS=Aureobasidium subglaciale EXF-2481. GN=AUEXF2481DRAFT_30093 OC=Aureobasidium.
Sequence
MSSAPSSKKGAAASTKKKVDVAVDQSTDYLNQVKKETKQAVSNDWDYKLALLVITILAFA
TRFYAITHPNQVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFAGWLVGYNGDFLFE
NIGDSYITNKVPYVAYRAMPATMGALTVSVVFMIMWESGYSLPACVLAAGLVLFDNAHIG
QTRLILLDATLILFMALSVLSYVRFYKLRHVPFSRKWWKWLLLTGVCLSCVISTKYVGAF
TFFSIGVPVAIDLWSLLDINRRQGALSLPEFGKHLAARVTGLIVIPFLLYLFWFQVHFAI
LSRSGPGDDFMSPEFQETLSDNIMTQQSVSIDYYDAINIRHKDTKVYLHSHPDKYPLRYD
DGRISSQGQQVTGYPHNDTNNLWQIVPGTGAIPEEVGHRVHVGDVVRLRHLVTDSWLLTH
DVASPYYPTNQEFTAVGHDEANGDRFNDTLFEIRVDGAKAGTDFKTMSVHFKLVHVNTKV
AMWTHTTPLPEWAYKQAEINGNKNALQTSNIWYAEDIPALPKDSERAKKEPRKVKHVPFL
KKYFELQRAMFYHNNALTSSHPYASVPIQWPFLLRGVSFWTDNETRQQIYFLGNPVGWWL
ASSLLAVFAGVLLADQLSQRRGVDALDKRTSILTLTSQKQANIFTGARNRLYNSTGFFFL
TWAAHYIPFYIMGRQLFLHHYLPAHLASALVTGALVEFVFNIDPVDIDDVTSGNATLTKN
KKTAVQQNKPVRERTGQSNLLGMWAATGGILAVIVWSFLYFAPLTYGQPGLTVEQVQARK
WLNYDLHFAK
Download sequence
Identical sequences A0A074YAD7
XP_013343144.1.23603 jgi|Aurpu_var_sub1|30093|fgenesh1_pg.12_#_157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]