SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074YQL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074YQL1
Domain Number 1 Region: 322-522
Classification Level Classification E-value
Superfamily MIR domain 2.79e-58
Family MIR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074YQL1
Sequence length 912
Comment (tr|A0A074YQL1|A0A074YQL1_AURPU) PMT-domain-containing protein {ECO:0000313|EMBL:KEQ89101.1} KW=Complete proteome; Reference proteome OX=1043002 OS=Aureobasidium pullulans EXF-150. GN=M438DRAFT_340919 OC=Aureobasidium.
Sequence
MANRAAKSPARQPNSKPVTKPNSFASEGVENYDVSTLKANDWLICSALSVVALFVRLFRI
SQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKLLITLAGWLAGFDGEFDFKDIGKDY
IEPRVPYVSMRLLPALMGVLTIPIMFLTLKASGCKTVTATMGAGLVLFENGLVTQSRLIL
LDSPLVIFTALTILGWTSFTNQHEQGPSKAFTPSWWFWLAFSGLCLGATVSVKWVGLFTI
AWIGSLTVLQLWVLLGDTKTVTPRLWFKHFFARFFCLVVIPVSFYMSMFAIHFLCLVNPG
DGDGFMSSEFQSTLNSKGMQDVPADVAFGSRVSIRHHNTQGGYLHSHSHMYPTGSKQQQI
TLYPHKDENNVWLLENQTQPIDIDGTDIPTPWAWDSIEPTLIEDGAVLKLYHIITDRRVH
SHDHRPPVTDADWQNEVSAYGYEGFEGDANDLFKVEIIKHLSDGEVAKNRVRTIQTKFKL
VHIMTGCVLFSHKVKLPDWGFEQQEVTCAKGGTEPNSIWYIESNEHPQLKEDAEKVNYRN
PGFFGKFWELQKVMWTTNAGLVESHAWDSRPQSWPILRRGINFWGKDHRQIYLIGNPLIW
WTSTVSVAVYLAFKALAVLRWQRGYRDYNNVPFKRFDYEVGTSVLGWALHWLPFFLMQRQ
LFLHHYFPALYFAIIALSQTYDFITARVPALGLRQRPVIGTAGAAIFLAMSISIFYMYSP
VAYGNAWTKTDCSKAKLFETWDWDCNTFYDSYSEYKTYDRTISPAKSTAAASPAVQFSHE
EIPEAQVTNRVESGEERIEYRDEAGNILNEEQVKELEGKVSFSTRYETRTRLVDANGNEV
YDGVAKEEESYAGTIAEGSNQETGGVGQDEANEQPASVNVNDDVEKEKSIEASTASAEPE
SDASAATGKDEL
Download sequence
Identical sequences A0A074YQL1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]