SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074Z334 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074Z334
Domain Number 1 Region: 2-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.03e-75
Family Capz beta-1 subunit 0.0000000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074Z334
Sequence length 283
Comment (tr|A0A074Z334|A0A074Z334_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEQ93466.1} KW=Complete proteome; Reference proteome OX=1043005 OS=Aureobasidium subglaciale EXF-2481. GN=AUEXF2481DRAFT_31045 OC=Aureobasidium.
Sequence
MADQFDSALDLLRRLNPKNTAANLSAICSLVPEHEEELLASVDQPLEVRRCKKTGRDYLL
CDYNRDGDSYRSPWSNEFDPPVDDAEMSSERVRRLEVRANEAFDVYRELYYEGGTSSVYL
WNLDDGFAGVVLLKKSSSQTAASGAWDSIHVLEVAERGRTAKYKLTSTVILNLGTKGDAL
GSLDLAGNMTRQVESDMPVDADETHVANVGKLVEDMELKMRNLLREHLLHVNTKRTVTNA
SQTEEVYFGKAKDVVGDLRSIPPLSEANRERAAQREMINSMGR
Download sequence
Identical sequences A0A074Z334
XP_013341997.1.23603 jgi|Aurpu_var_sub1|31045|fgenesh1_pg.16_#_13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]