SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074ZDY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZDY2
Domain Number 1 Region: 322-522
Classification Level Classification E-value
Superfamily MIR domain 4.32e-58
Family MIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074ZDY2
Sequence length 912
Comment (tr|A0A074ZDY2|A0A074ZDY2_9PEZI) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KEQ96876.1} KW=Complete proteome; Reference proteome OX=1043005 OS=Aureobasidium subglaciale EXF-2481. GN=AUEXF2481DRAFT_38283 OC=Aureobasidium.
Sequence
MANRAAKSPARQPNTKAVSKPKSFASEGVDNYDVTTLKSEDWLTCSALTVVALFVRLFRI
SQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKLLITLAGYLAGFDGEFDFKDIGKDY
IEPAVPYVSMRLLPALMGVLTIPIMFLTLKASGCKTTTAAMGAGLILFENGLVTQSRLIL
LDSPLVIFTALTVLGWTSFTNQHEQGPSKAFTPTWWFWLAFSGVALGATVSVKWVGLFTI
AWIGSLTLLQLWVLLGDTKTITPRLWFKHFFARFFCLVVIPVSFYMSMFAIHFLCLVNPG
DGDGFMSSEFQSTLNSKGMQDVPADVAFGSRVSIRHHNTQGGYLHSHTHMYPTGSKQQQI
TLYPHKDENNVWLLENQTQPVDFDGNDILTPFAWDNIEPTLIEDGAVLKLYHVITDRRVH
SHDHRPPVTDADWQNEVSAYGYEGFEGDANDLFKVEIVKHLSDGEAAKSRVRTIETKFKL
VHIMTGCVLFSHKVKLPDWGFEQQEVTCAKGGTLPNSIWYIESNEHPQLKEDAEKVNYRN
PGFFGKFWELQKVMWTTNAGLVESHAWDSRPQSWPILRRGINFWGKDHRQIYLIGNPLIW
WTSTVSVVVYLAFKALAVLRWQRGFKDYNNVPFKRFDYEVGTSVLGWALHWLPFFLMQRQ
LFLHHYFPALYFAIIALSQTYDFITARVSALGLRQRPVIGTAGAAIFLALSISIFYMYSP
VAYGNAWTKADCSKAKLFDTWDWDCNNFYDSYSEYKTYDRSIQAAQSTAAASPAVQFSHE
EVPEAQVTNRVDGEEKIEYRDEAGNLLNEEQVKELEGKVSFSTRYETRTRLVDANGNEIH
DGRAPAEEESFAGTIAEGSNQETGGVAQEAANDQPASVNVNDDIEKEKSVEASTVFAEPE
SDAGTATGRDEL
Download sequence
Identical sequences A0A074ZDY2
jgi|Aurpu_var_sub1|38283|fgenesh1_kg.6_#_159_#_Locus540v1rpkm360.85 XP_013345392.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]