SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075AUF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AUF0
Domain Number 1 Region: 28-151
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-41
Family Ran-binding domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075AUF0
Sequence length 156
Comment (tr|A0A075AUF0|A0A075AUF0_9FUNG) Ran-specific GTPase-activating protein 1-like protein {ECO:0000313|EMBL:EPZ33893.1} KW=Complete proteome; Reference proteome OX=988480 OS=Rozella allomycis CSF55. GN=O9G_002456 OC=Eukaryota; Fungi; Cryptomycota; Rozella.
Sequence
MTEETKPVVVEDKQPEQVEEHEEVEASPEVHFEPIVKLEAVEVKTNEEEETSLFKMRAKL
FRFEKATNEWKERGTGDVRFLQHNESKKVRLVMRRDKTHKVCANHYVTDEMELKPNVGSD
RSWVWTVAADVSEGVPAAELLAIRLANSESRNSGVI
Download sequence
Identical sequences A0A075AUF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]