SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075AZJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AZJ2
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.75e-54
Family Capz beta-1 subunit 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075AZJ2
Sequence length 230
Comment (tr|A0A075AZJ2|A0A075AZJ2_9FUNG) F-actin capping protein, beta subunit domain-containing protein {ECO:0000313|EMBL:EPZ34077.1} KW=Complete proteome; Reference proteome OX=988480 OS=Rozella allomycis CSF55. GN=O9G_005633 OC=Eukaryota; Fungi; Cryptomycota; Rozella.
Sequence
MDNKLDCALDIIRRLPPVLVENSLASLIDLEPNLAESLLSTVDVPLKVRMCSVSGKEYLL
CDYNRDGDSFRSPWSNAYEPEVFDEQLKPSAKLRELEELANEAFKTYKDFVYMWDLNCGF
AATVAIKKVEYKLTSTVMLYIIRDGQCNLSLTGSLTRQELTVLNAKFDHISNLGTMVEDM
ENKLRSNLQDIYFGKTKDIVNELRGLHSLQETNHKLGLQKEIMLLMKERK
Download sequence
Identical sequences A0A075AZJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]